SecReT4
Protein ID: 190571007
T4SS name [ID]VirB [485]
Gene symbol-
Locus tagWPa_0599
StrainWolbachia endosymbiont of Culex quinquefasciatus Pel
Repliconchromosome [GenBank: NC_010981] [Browse all T4SS(s) in this replicon]
Location [Strand]643950..647204 [-]
ProductTrlB/VirB6 plasmid conjugal transfer domain-containing protein
Component typeVirB6
UniProt IDB3CLD9
KEGG IDwpi:WPa_0599
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 6.8e-15, Aligned region: 351..560
Protein Sequence: 1084 a.a.     [Download]
>gi|190571007|ref|YP_001975365.1| TrlB/VirB6 plasmid conjugal transfer domain-containing protein [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
MQSRLGKCWFRLLILVICVLVTGCSKNDMPFPRCISADYFGPEPIAIGAHFPIGHDAFFPEGESGEPIDP
ETGEINYGFHPNQVVKWKDTGLETNGDSLVVRVNGAWTSWSNSNKKKSQSSYSLESLEQLKYATKFERGK
GDNSLPDFHLVCNDYKPSIQKFSSKPKESCTVKCKCINEDDSANTVSRGAPCWFTNGHGAYLLFKRPSDS
SPNENLKSMRNPESPTVHLGYNSVAEDGSGLFTLDRDNTTLQDRSCNTVRLEKGWKIYVKILDRYYLDNA
GGYSFEFLSGVQKPSNFGFFDYIYNYLKCVLLINENCKKHFDSNDPAAAQAIFQNIAEKSTSFHNFVLSL
LVLFIVISSLLYLFGMIRETKHDMLIRMMKITLVIVLISPGSFRFFYDHFLVLFVKGLEQLISIITNFAP
NMNTGGNSNVAQGNEAKLFSFMEDMFNKFFAYSVWKKFAAFLHYQMWASLLMIPAIFIGIVLYFLLCMYA
YIIFLSGFMGIAFLVAIMPLFLISILFSPLKSLFEGWIKFCISFCLQSIMIFTLLSLLAAMIMNTFYKQL
GFTVCYNKWLEIKLCAPKWVFGGFCIIDKEYFSWTPGQIFVPYAIGEASTLNVDKNIEGIEKLSRIGGTV
KFTGGAGYIPLPPDYINKGFRYIDYPFFNPIPGTKDNPADHYIAESDMIVSNGCSAKDLVRLTNSLSHAS
ERADIILLINNIEKRIGDVSEIIKRYCQDINKCNSYREIINEIRSLVRSAIKKQGCRILKLHDLYKDSNS
EYCQKCKDCEDCKNYKEDSDYQRVQDIQRGYLINAGEIFVLFLLSFLMFSLKEFVQQMGSSIAGGGFGVY
NISSMYQASPVTGLMQGLKQQMQDKIGGGLESLGNWATHVPDRLAGGTANLLGRIPGVGGVLKYAINVPR
KLVGATIEATKFATSPKNDVDKLEEKIYRAFGIDKEDIAHRRIDKYLEYYKGYVGSHLGYTIEDAMKFTW
EHGLDSIGTNPATGEKDGYQHNLLYRAKTYRREFLEKLHDYTIGRKREPEEDESSKENKPNQSNRKLGTE
PETLKNTTEAIRAGEDRERQDNERNENIENDEES
 
Nucleotide Sequence: 3255 bp     [Download]
>gi|190570478|ref|NC_010981.1|:c647204-643950 Wolbachia endosymbiont of Culex quinquefasciatus Pel chromosome, complete genome
ATGCAATCACGCTTAGGCAAATGTTGGTTTAGGTTATTAATTTTGGTAATCTGTGTTCTGGTTACAGGTT
GTAGTAAGAATGATATGCCTTTTCCAAGATGTATATCTGCTGATTATTTTGGTCCTGAACCCATTGCAAT
TGGTGCTCATTTTCCAATCGGTCATGATGCGTTTTTTCCAGAAGGTGAAAGTGGAGAACCTATTGATCCT
GAAACCGGAGAAATCAATTATGGTTTTCACCCTAATCAAGTAGTGAAGTGGAAGGATACCGGCCTTGAAA
CCAATGGAGATAGTTTAGTAGTACGAGTAAATGGTGCATGGACATCTTGGAGCAATAGTAATAAGAAGAA
ATCTCAAAGTAGTTATAGTTTGGAAAGTTTGGAGCAGTTAAAATATGCAACCAAATTTGAAAGAGGGAAA
GGTGACAACAGTCTGCCTGACTTTCACTTAGTTTGTAATGATTATAAACCTAGCATACAAAAATTTTCAA
GTAAGCCTAAAGAAAGTTGCACTGTAAAGTGCAAGTGCATTAATGAAGATGATAGCGCAAATACAGTATC
ACGTGGTGCTCCATGTTGGTTTACTAACGGCCATGGTGCTTATCTTTTATTTAAAAGGCCTAGCGATTCT
AGTCCTAACGAAAATTTAAAATCCATGCGTAACCCTGAGTCTCCTACTGTACATCTAGGTTACAATTCCG
TAGCGGAAGATGGAAGTGGGCTTTTTACTTTAGACAGAGATAACACCACATTACAGGACAGGAGTTGTAA
TACGGTGAGGTTAGAAAAAGGATGGAAAATATATGTAAAGATATTAGATAGATATTATCTAGATAATGCA
GGTGGCTACTCTTTTGAATTTTTGAGCGGAGTGCAGAAACCAAGTAACTTTGGATTTTTTGATTACATTT
ATAACTATCTAAAATGTGTATTATTGATTAACGAAAATTGTAAAAAGCATTTTGATAGCAATGATCCTGC
AGCTGCACAAGCGATATTTCAAAATATAGCTGAAAAAAGTACGAGCTTTCACAATTTTGTTCTTTCCTTG
CTTGTTCTATTTATAGTGATTTCATCGCTTCTTTATCTTTTTGGAATGATAAGAGAAACTAAGCATGATA
TGCTCATCAGAATGATGAAAATCACTCTAGTAATAGTGCTTATATCTCCTGGAAGTTTTAGATTTTTCTA
TGATCATTTTCTTGTTTTATTTGTTAAAGGTCTTGAACAATTGATAAGCATAATTACTAATTTTGCTCCC
AACATGAACACCGGAGGTAATTCAAACGTTGCTCAAGGAAATGAAGCTAAATTGTTTAGCTTCATGGAGG
ATATGTTTAATAAGTTTTTTGCTTACTCTGTTTGGAAAAAGTTTGCAGCATTTTTACATTATCAAATGTG
GGCAAGTCTCCTTATGATACCGGCAATTTTTATAGGGATTGTCTTATATTTCCTGCTGTGTATGTATGCT
TACATAATATTCCTTTCTGGTTTTATGGGTATAGCTTTTCTTGTAGCTATAATGCCGCTATTCCTAATCT
CTATTTTATTTTCACCACTGAAAAGTCTATTTGAGGGTTGGATAAAATTCTGTATTAGTTTCTGTTTGCA
ATCAATTATGATATTTACCCTGCTGTCATTACTTGCTGCGATGATAATGAATACCTTTTATAAACAGTTA
GGCTTTACTGTGTGCTATAATAAATGGCTTGAAATAAAGTTATGTGCTCCAAAATGGGTATTTGGTGGTT
TTTGTATAATTGATAAAGAATACTTTAGCTGGACTCCAGGGCAAATTTTTGTACCTTATGCTATTGGAGA
GGCTTCTACATTGAACGTAGATAAGAATATAGAAGGTATAGAAAAACTAAGCAGAATAGGTGGTACAGTA
AAGTTTACTGGTGGCGCTGGATATATCCCTCTTCCACCAGATTACATTAATAAAGGTTTTCGTTATATAG
ATTATCCTTTCTTTAATCCAATTCCTGGAACTAAAGATAATCCAGCAGACCACTATATTGCGGAAAGTGA
TATGATAGTTAGTAATGGCTGTAGTGCAAAAGATCTAGTACGCTTAACAAATAGTTTATCTCATGCATCA
GAGAGGGCTGACATTATATTACTGATCAACAATATAGAGAAAAGGATAGGTGATGTTAGTGAAATAATAA
AACGCTACTGTCAAGATATAAATAAATGCAATAGTTATAGGGAAATAATTAATGAAATAAGATCTTTAGT
GCGGAGTGCGATAAAAAAACAAGGTTGTAGAATACTGAAACTTCATGATTTATATAAGGATTCCAACAGT
GAATACTGTCAGAAATGTAAAGATTGTGAGGATTGCAAAAATTATAAAGAAGATAGTGATTACCAAAGGG
TGCAAGACATACAGAGAGGTTATTTAATCAACGCAGGAGAGATCTTTGTATTGTTCTTGCTTTCGTTTTT
GATGTTTTCTTTGAAGGAGTTTGTACAACAGATGGGCTCAAGCATTGCCGGTGGTGGGTTTGGTGTTTAC
AATATATCTAGTATGTATCAAGCATCACCTGTGACTGGTTTAATGCAGGGATTAAAACAACAGATGCAAG
ATAAAATTGGTGGAGGGCTAGAGTCTTTAGGTAATTGGGCTACTCATGTACCGGACAGATTAGCTGGAGG
TACAGCTAATTTGCTAGGTAGAATACCAGGAGTTGGGGGTGTGCTGAAATATGCTATTAATGTGCCACGT
AAGCTTGTAGGTGCTACTATTGAAGCAACAAAATTTGCAACATCACCTAAAAATGATGTTGATAAGCTTG
AGGAAAAAATCTACAGGGCGTTTGGAATTGATAAAGAAGATATTGCACATAGAAGAATTGATAAATATTT
AGAATATTATAAAGGATATGTAGGATCACATTTGGGCTATACAATAGAAGATGCTATGAAGTTTACTTGG
GAACATGGTCTCGACTCTATAGGAACTAACCCTGCTACAGGAGAAAAGGATGGTTACCAGCATAATCTAC
TCTATAGAGCAAAAACATATAGACGGGAATTTCTTGAGAAGCTTCATGACTACACTATTGGCCGCAAGAG
AGAACCAGAAGAAGATGAATCATCAAAAGAAAATAAGCCTAATCAATCAAATCGAAAATTAGGTACGGAA
CCAGAAACCCTAAAAAACACTACAGAAGCTATACGTGCCGGAGAAGATAGAGAGCGTCAAGATAATGAAA
GGAATGAGAACATAGAGAATGATGAAGAATCGTAA
 Primer design