SecReT4
Protein ID: 190571007
T4SS name [ID]VirB [485]
Gene symbol-
Locus tagWPa_0599
StrainWolbachia endosymbiont of Culex quinquefasciatus Pel
Repliconchromosome [GenBank: NC_010981] [Browse all T4SS(s) in this replicon]
Location [Strand]643950..647204 [-]
ProductTrlB/VirB6 plasmid conjugal transfer domain-containing protein
Component typeVirB6
UniProt IDB3CLD9
KEGG IDwpi:WPa_0599
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 6.8e-15, Aligned region: 351..560
Protein Sequence: 1084 a.a.     [Download]
>gi|190571007|ref|YP_001975365.1| TrlB/VirB6 plasmid conjugal transfer domain-containing protein [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
MQSRLGKCWFRLLILVICVLVTGCSKNDMPFPRCISADYFGPEPIAIGAHFPIGHDAFFPEGESGEPIDP
ETGEINYGFHPNQVVKWKDTGLETNGDSLVVRVNGAWTSWSNSNKKKSQSSYSLESLEQLKYATKFERGK
GDNSLPDFHLVCNDYKPSIQKFSSKPKESCTVKCKCINEDDSANTVSRGAPCWFTNGHGAYLLFKRPSDS
SPNENLKSMRNPESPTVHLGYNSVAEDGSGLFTLDRDNTTLQDRSCNTVRLEKGWKIYVKILDRYYLDNA
GGYSFEFLSGVQKPSNFGFFDYIYNYLKCVLLINENCKKHFDSNDPAAAQAIFQNIAEKSTSFHNFVLSL
LVLFIVISSLLYLFGMIRETKHDMLIRMMKITLVIVLISPGSFRFFYDHFLVLFVKGLEQLISIITNFAP
NMNTGGNSNVAQGNEAKLFSFMEDMFNKFFAYSVWKKFAAFLHYQMWASLLMIPAIFIGIVLYFLLCMYA
YIIFLSGFMGIAFLVAIMPLFLISILFSPLKSLFEGWIKFCISFCLQSIMIFTLLSLLAAMIMNTFYKQL
GFTVCYNKWLEIKLCAPKWVFGGFCIIDKEYFSWTPGQIFVPYAIGEASTLNVDKNIEGIEKLSRIGGTV
KFTGGAGYIPLPPDYINKGFRYIDYPFFNPIPGTKDNPADHYIAESDMIVSNGCSAKDLVRLTNSLSHAS
ERADIILLINNIEKRIGDVSEIIKRYCQDINKCNSYREIINEIRSLVRSAIKKQGCRILKLHDLYKDSNS
EYCQKCKDCEDCKNYKEDSDYQRVQDIQRGYLINAGEIFVLFLLSFLMFSLKEFVQQMGSSIAGGGFGVY
NISSMYQASPVTGLMQGLKQQMQDKIGGGLESLGNWATHVPDRLAGGTANLLGRIPGVGGVLKYAINVPR
KLVGATIEATKFATSPKNDVDKLEEKIYRAFGIDKEDIAHRRIDKYLEYYKGYVGSHLGYTIEDAMKFTW
EHGLDSIGTNPATGEKDGYQHNLLYRAKTYRREFLEKLHDYTIGRKREPEEDESSKENKPNQSNRKLGTE
PETLKNTTEAIRAGEDRERQDNERNENIENDEES
 
Nucleotide Sequence: 3255 bp     [Download]
>gi|190570478|ref|NC_010981.1|:c647204-643950 Wolbachia endosymbiont of Culex quinquefasciatus Pel chromosome, complete genome
ATGCAATCACGCTTAGGCAAATGTTGGTTTAGGTTATTAATTTTGGTAATCTGTGTTCTGGTTACAGGTT
GTAGTAAGAATGATATGCCTTTTCCAAGATGTATATCTGCTGATTATTTTGGTCCTGAACCCATTGCAAT
TGGTGCTCATTTTCCAATCGGTCATGATGCGTTTTTTCCAGAAGGTGAAAGTGGAGAACCTATTGATCCT
GAAACCGGAGAAATCAATTATGGTTTTCACCCTAATCAAGTAGTGAAGTGGAAGGATACCGGCCTTGAAA
CCAATGGAGATAGTTTAGTAGTACGAGTAAATGGTGCATGGACATCTTGGAGCAATAGTAATAAGAAGAA
ATCTCAAAGTAGTTATAGTTTGGAAAGTTTGGAGCAGTTAAAATATGCAACCAAATTTGAAAGAGGGAAA
GGTGACAACAGTCTGCCTGACTTTCACTTAGTTTGTAATGATTATAAACCTAGCATACAAAAATTTTCAA
GTAAGCCTAAAGAAAGTTGCACTGTAAAGTGCAAGTGCATTAATGAAGATGATAGCGCAAATACAGTATC
ACGTGGTGCTCCATGTTGGTTTACTAACGGCCATGGTGCTTATCTTTTATTTAAAAGGCCTAGCGATTCT
AGTCCTAACGAAAATTTAAAATCCATGCGTAACCCTGAGTCTCCTACTGTACATCTAGGTTACAATTCCG
TAGCGGAAGATGGAAGTGGGCTTTTTACTTTAGACAGAGATAACACCACATTACAGGACAGGAGTTGTAA
TACGGTGAGGTTAGAAAAAGGATGGAAAATATATGTAAAGATATTAGATAGATATTATCTAGATAATGCA
GGTGGCTACTCTTTTGAATTTTTGAGCGGAGTGCAGAAACCAAGTAACTTTGGATTTTTTGATTACATTT
ATAACTATCTAAAATGTGTATTATTGATTAACGAAAATTGTAAAAAGCATTTTGATAGCAATGATCCTGC
AGCTGCACAAGCGATATTTCAAAATATAGCTGAAAAAAGTACGAGCTTTCACAATTTTGTTCTTTCCTTG
CTTGTTCTATTTATAGTGATTTCATCGCTTCTTTATCTTTTTGGAATGATAAGAGAAACTAAGCATGATA
TGCTCATCAGAATGATGAAAATCACTCTAGTAATAGTGCTTATATCTCCTGGAAGTTTTAGATTTTTCTA
TGATCATTTTCTTGTTTTATTTGTTAAAGGTCTTGAACAATTGATAAGCATAATTACTAATTTTGCTCCC
AACATGAACACCGGAGGTAATTCAAACGTTGCTCAAGGAAATGAAGCTAAATTGTTTAGCTTCATGGAGG
ATATGTTTAATAAGTTTTTTGCTTACTCTGTTTGGAAAAAGTTTGCAGCATTTTTACATTATCAAATGTG
GGCAAGTCTCCTTATGATACCGGCAATTTTTATAGGGATTGTCTTATATTTCCTGCTGTGTATGTATGCT
TACATAATATTCCTTTCTGGTTTTATGGGTATAGCTTTTCTTGTAGCTATAATGCCGCTATTCCTAATCT
CTATTTTATTTTCACCACTGAAAAGTCTATTTGAGGGTTGGATAAAATTCTGTATTAGTTTCTGTTTGCA
ATCAATTATGATATTTACCCTGCTGTCATTACTTGCTGCGATGATAATGAATACCTTTTATAAACAGTTA
GGCTTTACTGTGTGCTATAATAAATGGCTTGAAATAAAGTTATGTGCTCCAAAATGGGTATTTGGTGGTT
TTTGTATAATTGATAAAGAATACTTTAGCTGGACTCCAGGGCAAATTTTTGTACCTTATGCTATTGGAGA
GGCTTCTACATTGAACGTAGATAAGAATATAGAAGGTATAGAAAAACTAAGCAGAATAGGTGGTACAGTA
AAGTTTACTGGTGGCGCTGGATATATCCCTCTTCCACCAGATTACATTAATAAAGGTTTTCGTTATATAG
ATTATCCTTTCTTTAATCCAATTCCTGGAACTAAAGATAATCCAGCAGACCACTATATTGCGGAAAGTGA
TATGATAGTTAGTAATGGCTGTAGTGCAAAAGATCTAGTACGCTTAACAAATAGTTTATCTCATGCATCA
GAGAGGGCTGACATTATATTACTGATCAACAATATAGAGAAAAGGATAGGTGATGTTAGTGAAATAATAA
AACGCTACTGTCAAGATATAAATAAATGCAATAGTTATAGGGAAATAATTAATGAAATAAGATCTTTAGT
GCGGAGTGCGATAAAAAAACAAGGTTGTAGAATACTGAAACTTCATGATTTATATAAGGATTCCAACAGT
GAATACTGTCAGAAATGTAAAGATTGTGAGGATTGCAAAAATTATAAAGAAGATAGTGATTACCAAAGGG
TGCAAGACATACAGAGAGGTTATTTAATCAACGCAGGAGAGATCTTTGTATTGTTCTTGCTTTCGTTTTT
GATGTTTTCTTTGAAGGAGTTTGTACAACAGATGGGCTCAAGCATTGCCGGTGGTGGGTTTGGTGTTTAC
AATATATCTAGTATGTATCAAGCATCACCTGTGACTGGTTTAATGCAGGGATTAAAACAACAGATGCAAG
ATAAAATTGGTGGAGGGCTAGAGTCTTTAGGTAATTGGGCTACTCATGTACCGGACAGATTAGCTGGAGG
TACAGCTAATTTGCTAGGTAGAATACCAGGAGTTGGGGGTGTGCTGAAATATGCTATTAATGTGCCACGT
AAGCTTGTAGGTGCTACTATTGAAGCAACAAAATTTGCAACATCACCTAAAAATGATGTTGATAAGCTTG
AGGAAAAAATCTACAGGGCGTTTGGAATTGATAAAGAAGATATTGCACATAGAAGAATTGATAAATATTT
AGAATATTATAAAGGATATGTAGGATCACATTTGGGCTATACAATAGAAGATGCTATGAAGTTTACTTGG
GAACATGGTCTCGACTCTATAGGAACTAACCCTGCTACAGGAGAAAAGGATGGTTACCAGCATAATCTAC
TCTATAGAGCAAAAACATATAGACGGGAATTTCTTGAGAAGCTTCATGACTACACTATTGGCCGCAAGAG
AGAACCAGAAGAAGATGAATCATCAAAAGAAAATAAGCCTAATCAATCAAATCGAAAATTAGGTACGGAA
CCAGAAACCCTAAAAAACACTACAGAAGCTATACGTGCCGGAGAAGATAGAGAGCGTCAAGATAATGAAA
GGAATGAGAACATAGAGAATGATGAAGAATCGTAA
 Primer design

Protein ID: 190571008
T4SS name [ID]VirB [485]
Gene symbol-
Locus tagWPa_0600
StrainWolbachia endosymbiont of Culex quinquefasciatus Pel
Repliconchromosome [GenBank: NC_010981] [Browse all T4SS(s) in this replicon]
Location [Strand]647286..650186 [-]
ProductTrbL/VirB6 plasmid conjugal transfer family protein
Component typeVirB6
UniProt IDB3CLE0
KEGG IDwpi:WPa_0600
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 5.2e-20, Aligned region: 591..785
Protein Sequence: 966 a.a.     [Download]
>gi|190571008|ref|YP_001975366.1| TrbL/VirB6 plasmid conjugal transfer family protein [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
MMSRKSLLLILCLVITGCTMDCVEPGLQSRNTSVSIDVPVREAGEGVKIHWVDSGQVISKDEKIKFTLGG
SVNFCPLKEGKNPKRVLVPAVFCANDLIPNYSNKLTDNASLDEREICGDIGFGNNEFYSNRRYVDTGIKA
NPGDKLSFSLVPREITIDYDNPQGKGISFDDNCYRTEKGDEKDRATIRDMLNGGKFFCGESGKRTVVEFP
PLNKEEMNKRRVLVGNGYTPYDNKVHFNKDYIQNSWINGALLDLRRTKIGLNELCNGKRCDFNELNKYSS
YELNCYYQNICYNAKGIGENCVSSIRYEKYDKGNTCDMYSHLKRIEDELKKIEENKRDSKQIDINLISNS
KLNFKEDRGDISWAEALVAKIGDFDDQDIAKGIQCFPNEKGAKGDNVCSQINYKFEDYSLRLNHDYKIKG
ITPGSSVMLAIASNGNYQLHRGGYHVEVTRSCNFDGGKKLYVYLGDNPPRDPSARKTNDFKKVKRLDKIT
EDNVDYYIIDGSHLVNEESKKIYFGINVENVEKDDITDKDSKYYEDNKYTVNLFLKRKINDFISSTVNKI
FDFITDGSEDGIKIPYEGYRKGLLQGIRALLILYVIFTVVGYMLGTIQLSKFDFIIRIFKIAFIAFAFSD
RSWEFFGTTLSGLFVEGSIYLVDSFSGYIGEGGKKFAFLDLTAGVLFTGETWLKFLSLMLSGPFGFIAFL
AILYATFVFLRCIISATFKYVISTVLVAFLLSLAPLFIVFILFQQTKTLFDNWIKTLAHVSLQPVILFSS
LSLLNQLMYSVLYNLTNFSACYQCLISVNFLSYDLCLMKSILPLGYSPGTSVDVALSTGERAGGHFAALP
IDLIQAFIYLIIASAMEAFVSISETMAQALFSSGYGVAQSVSHISRSASQAMLSTVGLDDRTQNMIHNIK
QGMSKDRSKIEAKLPDTPKQADGKGSAGREMSKSETLSQPDKQKDSDKTKGQVKED
 
Nucleotide Sequence: 2901 bp     [Download]
>gi|190570478|ref|NC_010981.1|:c650186-647286 Wolbachia endosymbiont of Culex quinquefasciatus Pel chromosome, complete genome
ATGATGAGCAGAAAATCATTATTATTGATACTATGTCTTGTAATTACTGGCTGCACAATGGATTGTGTTG
AACCTGGGCTGCAGAGCAGAAATACTAGTGTCAGTATAGATGTTCCAGTTCGTGAAGCTGGCGAAGGAGT
TAAAATTCATTGGGTTGATTCTGGTCAAGTAATTAGCAAGGATGAGAAAATCAAATTTACTCTTGGTGGG
TCAGTAAATTTTTGTCCTCTTAAAGAAGGGAAAAATCCAAAGAGAGTACTTGTGCCCGCTGTATTTTGTG
CTAATGATTTAATACCAAATTACAGTAATAAGTTAACTGATAATGCTAGTCTTGATGAACGAGAAATATG
TGGGGATATAGGCTTTGGAAATAATGAATTCTATAGCAATAGACGTTATGTAGATACTGGAATTAAAGCA
AATCCTGGTGATAAGTTAAGCTTTAGCTTAGTTCCCAGAGAGATAACGATTGATTATGACAATCCACAAG
GAAAAGGTATCAGTTTTGATGATAATTGCTATAGAACTGAAAAAGGGGATGAAAAAGATAGAGCTACAAT
AAGAGACATGCTAAACGGAGGAAAGTTCTTTTGTGGAGAAAGTGGTAAAAGAACTGTAGTAGAATTTCCG
CCGCTGAATAAAGAAGAAATGAATAAAAGAAGAGTGCTAGTTGGCAATGGCTACACTCCATATGATAATA
AGGTACATTTTAATAAGGATTATATTCAAAATTCATGGATAAATGGTGCGTTGTTAGATCTACGACGAAC
TAAAATAGGACTGAATGAATTATGTAATGGGAAAAGGTGTGATTTTAATGAGCTGAACAAATACAGTTCT
TATGAACTTAATTGTTACTATCAGAATATATGTTACAACGCAAAAGGTATAGGGGAGAATTGCGTCTCTT
CTATAAGGTATGAGAAGTATGATAAAGGAAATACATGTGACATGTATTCTCACCTTAAACGTATTGAGGA
TGAACTAAAAAAGATTGAAGAAAATAAGAGGGATTCTAAGCAGATTGACATTAATTTAATATCAAATTCT
AAATTAAACTTCAAAGAGGACAGAGGAGATATTTCTTGGGCCGAAGCTCTTGTTGCAAAAATTGGCGATT
TTGATGATCAGGATATTGCTAAAGGTATTCAATGTTTTCCAAATGAGAAAGGTGCGAAAGGAGATAATGT
ATGTTCACAGATTAATTATAAATTTGAAGATTACTCTCTGAGATTAAATCATGATTATAAAATAAAAGGT
ATAACACCTGGTAGTAGTGTGATGCTTGCTATAGCAAGTAATGGCAACTACCAACTTCATAGAGGTGGAT
ATCATGTTGAAGTAACTAGATCATGTAACTTTGATGGTGGTAAAAAATTGTATGTGTACTTAGGTGATAA
TCCGCCAAGGGATCCATCTGCTCGAAAGACTAATGATTTCAAAAAAGTAAAGAGGTTGGATAAAATAACA
GAGGATAATGTAGACTATTACATAATAGATGGAAGTCATTTGGTAAATGAAGAGTCTAAGAAAATATATT
TTGGTATTAATGTAGAAAACGTAGAGAAAGATGATATTACGGACAAAGATAGCAAATATTATGAAGATAA
CAAATACACAGTAAATTTATTTTTAAAAAGAAAAATAAACGATTTTATTTCATCAACTGTAAACAAGATT
TTTGATTTCATAACAGACGGGAGTGAAGACGGAATTAAAATTCCATATGAAGGATATAGAAAGGGGCTTC
TACAAGGAATAAGAGCTTTGCTTATTCTATACGTTATATTTACTGTTGTTGGCTATATGCTTGGAACAAT
ACAATTAAGTAAATTCGATTTTATTATAAGAATATTCAAAATAGCATTTATAGCTTTTGCTTTTAGTGAT
AGAAGTTGGGAATTCTTTGGTACAACTTTGTCTGGGCTTTTTGTTGAGGGTAGCATTTATTTAGTTGATA
GTTTTTCTGGCTATATAGGAGAAGGAGGTAAAAAATTTGCATTCTTAGATTTAACAGCCGGAGTATTATT
TACAGGAGAAACATGGCTGAAATTTTTATCTTTAATGCTATCAGGACCTTTTGGCTTTATTGCATTTTTG
GCAATACTTTATGCTACTTTTGTGTTTTTAAGATGCATTATTAGTGCTACGTTTAAGTATGTAATATCTA
CTGTTTTAGTGGCATTTTTATTGTCATTGGCACCTTTATTTATCGTATTTATTCTATTTCAACAAACTAA
AACATTATTTGATAATTGGATAAAAACGCTGGCTCATGTTTCATTGCAACCAGTCATTTTATTTTCATCC
TTGTCTCTTTTAAACCAGTTAATGTATTCAGTTCTATACAACCTCACAAATTTTTCTGCATGCTATCAAT
GCTTAATTAGTGTAAATTTTTTATCGTATGATCTGTGTCTTATGAAATCAATATTACCTCTTGGGTATAG
TCCTGGTACTAGTGTTGATGTTGCGCTCAGTACTGGAGAAAGGGCTGGTGGGCACTTTGCAGCATTACCT
ATAGATCTAATCCAGGCATTTATATATCTCATCATTGCTAGTGCAATGGAAGCTTTTGTTTCTATATCAG
AAACTATGGCGCAGGCGTTGTTCAGCTCTGGTTATGGAGTTGCTCAAAGTGTTAGTCATATTTCTAGGAG
CGCATCACAAGCTATGCTGTCAACTGTTGGCCTTGATGATAGAACCCAAAATATGATACATAACATCAAG
CAGGGAATGAGTAAAGATCGTAGCAAAATTGAAGCTAAATTGCCTGATACACCAAAGCAAGCAGATGGGA
AAGGGAGTGCTGGCAGAGAAATGAGCAAATCTGAAACACTAAGCCAGCCAGATAAGCAAAAGGATTCTGA
TAAAACAAAAGGACAAGTCAAGGAAGATTGA
 Primer design

Protein ID: 190571010
T4SS name [ID]VirB [485]
Gene symbol-
Locus tagWPa_0602
StrainWolbachia endosymbiont of Culex quinquefasciatus Pel
Repliconchromosome [GenBank: NC_010981] [Browse all T4SS(s) in this replicon]
Location [Strand]652573..655149 [-]
Producttype IV secretion system protein VirB6
Component typeVirB6
UniProt IDB3CLE2
KEGG IDwpi:WPa_0602
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 5.5e-11, Aligned region: 576..677
Protein Sequence: 858 a.a.     [Download]
>gi|190571010|ref|YP_001975368.1| type IV secretion system protein VirB6 [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
MFKTKLSLLLVAIFLLNIDFLLSYPVFADTVSGTDKTEFVSRFNSTGSFSRASNPDCKAFETAAAVAGIA
IAIGAIFTGIVLIVSSAGLFTALVIVGMIAAIVGVWKAIGGLVVCEHSFVKHPVARDHDGKYKDFEFSKS
EYSKYSDCTNKNYQKEDEYFKCFDGANGSIEVGRKIEKGILNSIPDQNTGGYYWPKNGVQYSEYIEVCHR
NPLTFSRLFWLDTSIKADFDVREKDTGYEGGSWSPKVDGDLECKVLKAGQSETIHGSTFKAVKKMDRLCV
ELASVRMLGIKMTPWPQGVDMGCTELPPDPLAPMCEKSVMIFKNKDGTGEYEEDLNDSKNKDKDYKTIIR
EKKGEGKIFVGYNNASCFSQYVSEACYNQAGSKSLSPIPITSMIVQCIKESLDNLVAGIDSSGNLLTDKN
GHAKGSFLSVAQKRLKNTVTAILILALILFSIKVMSGGVRSPQEMYMLIIKFALVIYFTTGSTMSHYYGE
LTKLSNGLSEIVLKASSESKNICNYEAGKDYEYDRAGQKVSYSYLAPWDRLDCRILFYLGAPLDGIGGKI
GTGGVATLAVLLGAAPVLLVAGSVIGIIFAGGQILVALVCIFMAILMMMVILWMCYVFILSLVALSVIII
LSPLFIPMVLFQHTKGYFDGWLKELITYSLYPVILFAFLSFMFIACDKIYFKNLNFKLDESYKNEQPDKS
YEKKQAEISYSKKKQWFKLKDGECDKNETTLACMMQNYSFKKSSILGLFDFRYMEFGSSLIGELLKLCLV
LFLFYHFLNVLPGMAAELAGNHRAALGSGSTPAQMVNKALSAAKAAAGGAGQVAAAAVNKARGAIGGGGD
DNKGSGSSSSESIKSGGE
 
Nucleotide Sequence: 2577 bp     [Download]
>gi|190570478|ref|NC_010981.1|:c655149-652573 Wolbachia endosymbiont of Culex quinquefasciatus Pel chromosome, complete genome
ATGTTTAAAACTAAACTGTCATTACTGTTAGTTGCGATATTTTTGTTAAATATAGATTTTTTGCTCTCGT
ATCCAGTGTTTGCAGATACAGTAAGTGGTACTGACAAAACGGAATTTGTTAGCAGATTTAATTCTACTGG
CAGCTTTAGTCGTGCTTCTAATCCTGACTGTAAGGCGTTTGAAACAGCTGCAGCAGTTGCTGGGATAGCA
ATTGCTATTGGTGCAATATTTACTGGTATTGTTTTGATTGTCTCTTCTGCTGGTTTATTTACTGCTCTTG
TTATCGTTGGAATGATAGCTGCAATTGTTGGGGTTTGGAAGGCGATAGGAGGACTTGTTGTTTGTGAGCA
TAGTTTTGTTAAACACCCAGTTGCACGTGATCATGATGGAAAGTATAAAGATTTCGAATTCTCAAAATCA
GAATACTCAAAATATTCAGATTGCACAAATAAGAATTATCAAAAGGAAGATGAATATTTTAAATGTTTTG
ATGGGGCAAATGGATCAATAGAAGTAGGTAGAAAAATAGAGAAGGGCATTTTAAACTCCATACCTGACCA
AAATACTGGTGGTTATTACTGGCCAAAAAACGGTGTGCAATACAGTGAATATATAGAAGTATGCCATAGA
AATCCTTTAACATTTAGCAGATTGTTTTGGTTAGATACATCAATAAAAGCAGACTTTGATGTTAGAGAGA
AGGACACTGGATATGAAGGTGGGTCATGGTCTCCAAAAGTTGATGGTGATCTGGAATGTAAAGTTCTTAA
AGCAGGACAAAGCGAAACCATACATGGGTCAACATTCAAGGCAGTAAAAAAAATGGACAGATTGTGTGTG
GAGCTGGCAAGTGTGAGAATGCTTGGTATCAAAATGACTCCTTGGCCGCAAGGGGTTGATATGGGATGCA
CAGAATTGCCACCTGACCCACTTGCTCCTATGTGTGAAAAATCTGTGATGATATTCAAAAATAAAGATGG
TACAGGTGAATATGAGGAAGATCTTAATGATTCTAAAAATAAGGACAAAGATTACAAAACTATTATAAGG
GAAAAGAAAGGAGAGGGAAAAATTTTTGTAGGTTATAATAATGCCAGTTGTTTTAGCCAGTATGTCTCTG
AAGCTTGCTACAATCAAGCGGGAAGTAAGTCATTATCTCCTATTCCTATAACTTCTATGATAGTGCAATG
TATTAAGGAGTCGTTAGATAATTTAGTGGCAGGTATTGATTCAAGTGGTAACTTACTTACAGACAAAAAT
GGACATGCTAAGGGTAGTTTTTTGTCTGTAGCACAAAAAAGACTGAAGAACACTGTTACTGCTATCTTAA
TTTTAGCTTTGATATTGTTCTCTATAAAAGTTATGTCTGGTGGAGTGCGTAGTCCGCAAGAAATGTACAT
GTTGATCATTAAATTCGCTTTAGTGATTTACTTTACGACAGGTAGCACTATGTCTCATTATTACGGGGAA
TTAACAAAACTTTCGAACGGCTTATCAGAAATAGTGCTTAAAGCTTCATCTGAGAGTAAAAATATATGTA
ATTATGAGGCAGGTAAAGATTATGAATACGATCGTGCAGGGCAGAAGGTATCCTACAGTTATCTTGCACC
TTGGGATAGGCTTGATTGCAGAATTTTATTTTATTTAGGTGCCCCTTTAGATGGAATTGGTGGCAAAATT
GGTACTGGAGGTGTTGCAACGTTAGCGGTCTTGCTTGGCGCTGCTCCTGTCTTGTTAGTTGCAGGTTCGG
TGATTGGTATTATTTTCGCTGGTGGACAAATTTTAGTAGCTCTTGTCTGTATATTTATGGCCATTTTGAT
GATGATGGTTATTTTATGGATGTGCTATGTATTTATCTTATCTTTAGTTGCGCTTAGTGTAATTATCATC
TTATCGCCTTTATTCATTCCTATGGTTTTGTTTCAACATACTAAAGGATATTTTGATGGTTGGCTAAAAG
AGTTAATTACCTACAGTTTATACCCAGTTATCCTCTTTGCATTTCTATCTTTTATGTTCATAGCATGTGA
TAAAATCTATTTTAAAAATTTAAATTTTAAACTGGACGAGTCATATAAAAATGAACAACCAGACAAGTCA
TATGAAAAGAAACAAGCAGAAATCTCATATAGTAAGAAAAAACAGTGGTTTAAATTGAAAGATGGGGAAT
GTGATAAAAATGAAACTACTCTCGCATGTATGATGCAAAATTATAGCTTTAAAAAGAGCAGCATACTTGG
TCTATTCGACTTTAGATACATGGAGTTTGGCAGCTCTCTAATCGGAGAATTATTAAAATTGTGTTTAGTA
TTATTCCTCTTTTACCACTTTTTAAACGTTCTTCCCGGCATGGCTGCTGAGCTTGCTGGTAATCACAGAG
CAGCACTTGGTTCAGGTAGCACTCCTGCACAAATGGTGAATAAAGCTTTATCTGCTGCCAAAGCTGCTGC
TGGAGGTGCTGGTCAAGTTGCTGCTGCGGCTGTAAATAAGGCAAGAGGGGCTATTGGAGGAGGTGGAGAT
GATAATAAGGGATCGGGATCTTCCTCTAGTGAATCTATAAAATCAGGTGGAGAGTGA
 Primer design