SecReT4
Protein ID: 190571008
T4SS name [ID]VirB [485]
Gene symbol-
Locus tagWPa_0600
StrainWolbachia endosymbiont of Culex quinquefasciatus Pel
Repliconchromosome [GenBank: NC_010981] [Browse all T4SS(s) in this replicon]
Location [Strand]647286..650186 [-]
ProductTrbL/VirB6 plasmid conjugal transfer family protein
Component typeVirB6
UniProt IDB3CLE0
KEGG IDwpi:WPa_0600
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 5.2e-20, Aligned region: 591..785
Protein Sequence: 966 a.a.     [Download]
>gi|190571008|ref|YP_001975366.1| TrbL/VirB6 plasmid conjugal transfer family protein [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
MMSRKSLLLILCLVITGCTMDCVEPGLQSRNTSVSIDVPVREAGEGVKIHWVDSGQVISKDEKIKFTLGG
SVNFCPLKEGKNPKRVLVPAVFCANDLIPNYSNKLTDNASLDEREICGDIGFGNNEFYSNRRYVDTGIKA
NPGDKLSFSLVPREITIDYDNPQGKGISFDDNCYRTEKGDEKDRATIRDMLNGGKFFCGESGKRTVVEFP
PLNKEEMNKRRVLVGNGYTPYDNKVHFNKDYIQNSWINGALLDLRRTKIGLNELCNGKRCDFNELNKYSS
YELNCYYQNICYNAKGIGENCVSSIRYEKYDKGNTCDMYSHLKRIEDELKKIEENKRDSKQIDINLISNS
KLNFKEDRGDISWAEALVAKIGDFDDQDIAKGIQCFPNEKGAKGDNVCSQINYKFEDYSLRLNHDYKIKG
ITPGSSVMLAIASNGNYQLHRGGYHVEVTRSCNFDGGKKLYVYLGDNPPRDPSARKTNDFKKVKRLDKIT
EDNVDYYIIDGSHLVNEESKKIYFGINVENVEKDDITDKDSKYYEDNKYTVNLFLKRKINDFISSTVNKI
FDFITDGSEDGIKIPYEGYRKGLLQGIRALLILYVIFTVVGYMLGTIQLSKFDFIIRIFKIAFIAFAFSD
RSWEFFGTTLSGLFVEGSIYLVDSFSGYIGEGGKKFAFLDLTAGVLFTGETWLKFLSLMLSGPFGFIAFL
AILYATFVFLRCIISATFKYVISTVLVAFLLSLAPLFIVFILFQQTKTLFDNWIKTLAHVSLQPVILFSS
LSLLNQLMYSVLYNLTNFSACYQCLISVNFLSYDLCLMKSILPLGYSPGTSVDVALSTGERAGGHFAALP
IDLIQAFIYLIIASAMEAFVSISETMAQALFSSGYGVAQSVSHISRSASQAMLSTVGLDDRTQNMIHNIK
QGMSKDRSKIEAKLPDTPKQADGKGSAGREMSKSETLSQPDKQKDSDKTKGQVKED
 
Nucleotide Sequence: 2901 bp     [Download]
>gi|190570478|ref|NC_010981.1|:c650186-647286 Wolbachia endosymbiont of Culex quinquefasciatus Pel chromosome, complete genome
ATGATGAGCAGAAAATCATTATTATTGATACTATGTCTTGTAATTACTGGCTGCACAATGGATTGTGTTG
AACCTGGGCTGCAGAGCAGAAATACTAGTGTCAGTATAGATGTTCCAGTTCGTGAAGCTGGCGAAGGAGT
TAAAATTCATTGGGTTGATTCTGGTCAAGTAATTAGCAAGGATGAGAAAATCAAATTTACTCTTGGTGGG
TCAGTAAATTTTTGTCCTCTTAAAGAAGGGAAAAATCCAAAGAGAGTACTTGTGCCCGCTGTATTTTGTG
CTAATGATTTAATACCAAATTACAGTAATAAGTTAACTGATAATGCTAGTCTTGATGAACGAGAAATATG
TGGGGATATAGGCTTTGGAAATAATGAATTCTATAGCAATAGACGTTATGTAGATACTGGAATTAAAGCA
AATCCTGGTGATAAGTTAAGCTTTAGCTTAGTTCCCAGAGAGATAACGATTGATTATGACAATCCACAAG
GAAAAGGTATCAGTTTTGATGATAATTGCTATAGAACTGAAAAAGGGGATGAAAAAGATAGAGCTACAAT
AAGAGACATGCTAAACGGAGGAAAGTTCTTTTGTGGAGAAAGTGGTAAAAGAACTGTAGTAGAATTTCCG
CCGCTGAATAAAGAAGAAATGAATAAAAGAAGAGTGCTAGTTGGCAATGGCTACACTCCATATGATAATA
AGGTACATTTTAATAAGGATTATATTCAAAATTCATGGATAAATGGTGCGTTGTTAGATCTACGACGAAC
TAAAATAGGACTGAATGAATTATGTAATGGGAAAAGGTGTGATTTTAATGAGCTGAACAAATACAGTTCT
TATGAACTTAATTGTTACTATCAGAATATATGTTACAACGCAAAAGGTATAGGGGAGAATTGCGTCTCTT
CTATAAGGTATGAGAAGTATGATAAAGGAAATACATGTGACATGTATTCTCACCTTAAACGTATTGAGGA
TGAACTAAAAAAGATTGAAGAAAATAAGAGGGATTCTAAGCAGATTGACATTAATTTAATATCAAATTCT
AAATTAAACTTCAAAGAGGACAGAGGAGATATTTCTTGGGCCGAAGCTCTTGTTGCAAAAATTGGCGATT
TTGATGATCAGGATATTGCTAAAGGTATTCAATGTTTTCCAAATGAGAAAGGTGCGAAAGGAGATAATGT
ATGTTCACAGATTAATTATAAATTTGAAGATTACTCTCTGAGATTAAATCATGATTATAAAATAAAAGGT
ATAACACCTGGTAGTAGTGTGATGCTTGCTATAGCAAGTAATGGCAACTACCAACTTCATAGAGGTGGAT
ATCATGTTGAAGTAACTAGATCATGTAACTTTGATGGTGGTAAAAAATTGTATGTGTACTTAGGTGATAA
TCCGCCAAGGGATCCATCTGCTCGAAAGACTAATGATTTCAAAAAAGTAAAGAGGTTGGATAAAATAACA
GAGGATAATGTAGACTATTACATAATAGATGGAAGTCATTTGGTAAATGAAGAGTCTAAGAAAATATATT
TTGGTATTAATGTAGAAAACGTAGAGAAAGATGATATTACGGACAAAGATAGCAAATATTATGAAGATAA
CAAATACACAGTAAATTTATTTTTAAAAAGAAAAATAAACGATTTTATTTCATCAACTGTAAACAAGATT
TTTGATTTCATAACAGACGGGAGTGAAGACGGAATTAAAATTCCATATGAAGGATATAGAAAGGGGCTTC
TACAAGGAATAAGAGCTTTGCTTATTCTATACGTTATATTTACTGTTGTTGGCTATATGCTTGGAACAAT
ACAATTAAGTAAATTCGATTTTATTATAAGAATATTCAAAATAGCATTTATAGCTTTTGCTTTTAGTGAT
AGAAGTTGGGAATTCTTTGGTACAACTTTGTCTGGGCTTTTTGTTGAGGGTAGCATTTATTTAGTTGATA
GTTTTTCTGGCTATATAGGAGAAGGAGGTAAAAAATTTGCATTCTTAGATTTAACAGCCGGAGTATTATT
TACAGGAGAAACATGGCTGAAATTTTTATCTTTAATGCTATCAGGACCTTTTGGCTTTATTGCATTTTTG
GCAATACTTTATGCTACTTTTGTGTTTTTAAGATGCATTATTAGTGCTACGTTTAAGTATGTAATATCTA
CTGTTTTAGTGGCATTTTTATTGTCATTGGCACCTTTATTTATCGTATTTATTCTATTTCAACAAACTAA
AACATTATTTGATAATTGGATAAAAACGCTGGCTCATGTTTCATTGCAACCAGTCATTTTATTTTCATCC
TTGTCTCTTTTAAACCAGTTAATGTATTCAGTTCTATACAACCTCACAAATTTTTCTGCATGCTATCAAT
GCTTAATTAGTGTAAATTTTTTATCGTATGATCTGTGTCTTATGAAATCAATATTACCTCTTGGGTATAG
TCCTGGTACTAGTGTTGATGTTGCGCTCAGTACTGGAGAAAGGGCTGGTGGGCACTTTGCAGCATTACCT
ATAGATCTAATCCAGGCATTTATATATCTCATCATTGCTAGTGCAATGGAAGCTTTTGTTTCTATATCAG
AAACTATGGCGCAGGCGTTGTTCAGCTCTGGTTATGGAGTTGCTCAAAGTGTTAGTCATATTTCTAGGAG
CGCATCACAAGCTATGCTGTCAACTGTTGGCCTTGATGATAGAACCCAAAATATGATACATAACATCAAG
CAGGGAATGAGTAAAGATCGTAGCAAAATTGAAGCTAAATTGCCTGATACACCAAAGCAAGCAGATGGGA
AAGGGAGTGCTGGCAGAGAAATGAGCAAATCTGAAACACTAAGCCAGCCAGATAAGCAAAAGGATTCTGA
TAAAACAAAAGGACAAGTCAAGGAAGATTGA
 Primer design