SecReT4
Protein ID: 190571011
T4SS name [ID]VirB [485]
Gene symbol-
Locus tagWPa_0603
StrainWolbachia endosymbiont of Culex quinquefasciatus Pel
Repliconchromosome [GenBank: NC_010981] [Browse all T4SS(s) in this replicon]
Location [Strand]655142..657547 [-]
Producttype IV secretion system ATPase VirB4
Component typeVirB4
UniProt IDB3CLE3
KEGG IDwpi:WPa_0603
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 1.3e-59, Aligned region: 191..395
AAA_10 [PF12846], Evalue: 1.2e-34, Aligned region: 448..724
Protein Sequence: 801 a.a.     [Download]
>gi|190571011|ref|YP_001975369.1| type IV secretion system ATPase VirB4 [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
MLRFRAIQSKNKSILSREVHAAEFIPYSCYWNSTTLITKQNWLVKFIKLNGFAFETADDEDLVIQNNIRN
QMLRSISSPAFSLYFHTIRRKKNIFSDEFANQSLPNFFANHVNLKWREKHATRQSFINDLYITIIRRADT
KGVEFLSHLLKKFGHVTSKHAWESDMRDTYEDLEETTNRIVTSLRNYSPKVLGVKETPNGLFCEIMEFLS
RVVNCGFVTNTLFPLKTEISRYLPVHRLFFGHKMIQVVTHNESKYAGIVSIKEYGNNTSAGMLDSFLQLP
YEFIITQSFQFTNRQMAIAKMQIQQNRMIQSADKAISQIAEISHALDDAMSGKIAFGEHHLTILCIEKSP
KSLDNALSLVESELSNCGVYPVRERVNLEPAFWAQIPGNFDYIVRKGTISSLNLAGFASQHNYPTGKKFN
NHWGDAVTVFDTTSGTPFFFNFHIRDVGHTMIIGPTGAGKTVLMNFLCAQAMKFSPRIFFFDKDRGAEIF
LRALGGIYTIIEPRTKTNFNPLQLDDTPDNKTFLMEWIKSLILVYNDKFTSEDIARINDAIEGNFKLKKE
DRFLRNLVPFLGLAGPDTLAGAISMWHDDGSHSAIFDNKEDLLDFSKARVFGFEMASLLKDPVALGPVLI
YLFHRISISLDGTPSIIVLDEAWALIDNPVFAPKIKDWLKVLRKLNAFVVFATQSVEDASKSAISDTLVQ
QTATQIFLPNLKATSVYRDVFMLTEREYILIKHTDPSTRFFLVKQGVNAVVARIDLKDLDDVVNVLSGRA
ESVLLLYDILKEVGDDPKMWLPVFYQKVKNV
 
Nucleotide Sequence: 2406 bp     [Download]
>gi|190570478|ref|NC_010981.1|:c657547-655142 Wolbachia endosymbiont of Culex quinquefasciatus Pel chromosome, complete genome
ATGTTGAGATTTAGAGCTATTCAATCAAAGAATAAATCTATTCTAAGTAGAGAGGTTCACGCTGCCGAAT
TTATACCTTATTCTTGCTATTGGAATAGTACAACCTTGATAACAAAGCAGAATTGGTTAGTTAAATTTAT
AAAATTAAATGGCTTTGCGTTTGAAACGGCCGATGATGAAGACTTGGTGATACAAAATAATATCAGAAAT
CAGATGCTAAGAAGCATTTCATCTCCAGCATTTAGTTTGTACTTTCATACCATCAGACGTAAGAAAAATA
TTTTTTCTGATGAATTTGCAAATCAGAGTTTACCAAATTTTTTTGCTAACCATGTAAATCTAAAATGGAG
AGAAAAACACGCAACTAGGCAATCTTTTATTAATGATTTATACATTACGATTATTCGTAGGGCAGATACA
AAGGGAGTAGAATTTTTATCACATCTACTGAAAAAATTTGGGCATGTAACTTCAAAACATGCTTGGGAAA
GTGATATGCGTGATACCTATGAAGATTTAGAGGAAACGACAAATCGTATAGTAACAAGCCTTAGGAATTA
TTCGCCTAAAGTCCTTGGAGTAAAAGAAACTCCAAACGGACTGTTTTGTGAAATAATGGAGTTTCTGTCT
AGAGTTGTAAATTGTGGCTTTGTTACAAATACGCTTTTTCCACTAAAAACTGAAATATCAAGATACTTAC
CAGTTCATAGGTTATTTTTTGGCCATAAGATGATACAGGTTGTGACTCATAATGAAAGTAAATATGCTGG
AATAGTTAGTATCAAAGAATATGGAAATAATACTTCCGCAGGAATGCTTGATTCTTTTTTACAACTTCCT
TATGAATTTATTATCACGCAGTCTTTTCAATTTACAAATAGGCAAATGGCAATTGCGAAAATGCAGATAC
AGCAAAATCGTATGATACAATCTGCAGATAAAGCTATTTCTCAAATAGCAGAAATTTCTCATGCGCTTGA
TGATGCAATGAGTGGTAAAATTGCGTTTGGTGAACACCATTTAACTATCTTATGTATAGAAAAAAGCCCT
AAATCATTGGACAATGCTTTATCATTGGTTGAATCGGAGCTTTCTAATTGTGGTGTTTATCCTGTTCGTG
AGAGGGTTAATTTAGAACCAGCATTTTGGGCGCAAATTCCTGGTAATTTTGATTATATAGTAAGAAAAGG
TACAATAAGTAGTCTTAATTTGGCCGGTTTTGCATCTCAACATAATTATCCTACTGGTAAAAAATTCAAT
AACCACTGGGGAGATGCTGTTACAGTTTTTGATACAACATCTGGCACTCCATTTTTCTTCAACTTTCATA
TAAGGGATGTTGGACATACTATGATAATTGGGCCAACAGGTGCTGGCAAAACTGTTTTAATGAATTTTTT
ATGTGCTCAAGCAATGAAATTTTCTCCAAGAATATTCTTTTTTGATAAAGATCGCGGTGCAGAAATTTTT
TTAAGAGCACTTGGTGGTATCTATACTATAATAGAACCAAGAACTAAGACAAATTTTAATCCTCTGCAAC
TTGACGATACTCCTGATAATAAAACATTTTTGATGGAATGGATAAAATCTTTAATTTTAGTGTACAACGA
TAAATTCACTTCAGAAGATATTGCTAGAATTAATGATGCAATTGAGGGAAATTTTAAATTAAAAAAAGAA
GACAGATTTTTGAGAAATCTTGTACCATTTTTAGGACTTGCGGGCCCTGATACTCTAGCTGGAGCAATAT
CTATGTGGCATGATGATGGCTCTCATTCTGCAATATTTGACAATAAAGAAGATTTGCTAGATTTTTCAAA
AGCAAGAGTGTTTGGCTTTGAAATGGCTAGCTTGCTAAAAGATCCTGTTGCTCTTGGGCCGGTCTTGATT
TATTTGTTTCATAGGATTAGTATATCGCTTGATGGCACTCCATCCATTATTGTTCTTGATGAAGCATGGG
CGTTAATAGATAATCCAGTTTTTGCACCTAAGATAAAAGACTGGTTGAAAGTGCTGAGAAAGTTAAATGC
TTTTGTGGTTTTTGCTACTCAGAGTGTTGAAGATGCAAGTAAAAGTGCTATTAGTGATACGCTTGTACAG
CAGACAGCAACACAAATTTTTTTGCCAAATCTGAAAGCTACTAGTGTCTATCGAGATGTTTTTATGTTAA
CTGAACGTGAGTACATACTGATCAAACACACAGATCCAAGTACTAGATTCTTTTTAGTAAAGCAGGGAGT
TAATGCTGTAGTAGCTAGAATAGATCTGAAAGATTTGGATGATGTGGTCAACGTGTTATCTGGACGTGCG
GAAAGTGTTCTATTGTTATATGATATACTGAAAGAAGTCGGAGATGATCCAAAGATGTGGTTGCCTGTGT
TTTATCAAAAGGTGAAAAATGTTTAA
 Primer design