SecReT4
Protein ID: 190571012
T4SS name [ID]VirB [485]
Gene symbol-
Locus tagWPa_0604
StrainWolbachia endosymbiont of Culex quinquefasciatus Pel
Repliconchromosome [GenBank: NC_010981] [Browse all T4SS(s) in this replicon]
Location [Strand]657557..657853 [-]
Producttype IV secretion system protein VirB3
Component typeVirB3
UniProt IDB3CLE4
KEGG IDwpi:WPa_0604
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 1.7e-13, Aligned region: 1..89
Protein Sequence: 98 a.a.     [Download]
>gi|190571012|ref|YP_001975370.1| type IV secretion system protein VirB3 [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
MSTGSIQTNQLFKGLTRPAMLFGVSYMFAILNVLICMLIFINTNDLRVILLMLPGIHGLGYIASAKEPLF
IELFMVKLGKCSKCLNRFYHGANSYDIT
 
Nucleotide Sequence: 297 bp     [Download]
>gi|190570478|ref|NC_010981.1|:c657853-657557 Wolbachia endosymbiont of Culex quinquefasciatus Pel chromosome, complete genome
ATGTCTACTGGCAGCATACAAACGAATCAATTATTTAAAGGTCTTACAAGACCTGCAATGCTCTTTGGTG
TGAGTTATATGTTTGCAATATTAAACGTTCTAATTTGCATGCTAATTTTCATTAATACAAATGATCTTAG
AGTAATTCTCCTGATGTTACCAGGTATACATGGACTTGGCTATATAGCTTCTGCAAAGGAACCGTTGTTT
ATTGAGTTATTTATGGTAAAGTTGGGAAAATGTTCCAAATGTTTAAATCGGTTTTATCATGGAGCCAATT
CTTATGACATTACTTGA
 Primer design