SecReT4
Protein ID: 190571043
T4SS name [ID]VirB [485]
Gene symbol-
Locus tagWPa_0636
StrainWolbachia endosymbiont of Culex quinquefasciatus Pel
Repliconchromosome [GenBank: NC_010981] [Browse all T4SS(s) in this replicon]
Location [Strand]694193..696547 [+]
Producttype IV secretion system protein VirB4
Component typeVirB4
UniProt IDB3CLH6
KEGG IDwpi:WPa_0636
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 2.5e-29, Aligned region: 183..381
AAA_10 [PF12846], Evalue: 2.5e-21, Aligned region: 437..710
Protein Sequence: 784 a.a.     [Download]
>gi|190571043|ref|YP_001975401.1| type IV secretion system protein VirB4 [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
MQPKVPATRSNSEKKNNLALLESINLDFIPYACHYDEETILTKQGELLKIIKLEDYSSVDNYGDLRTEIR
KSISKNIKSLYFTVWIHTVRKRNKLSLQWNKTSDFSDQLHSTWFNKLVDSKLQYINELYIVVLLSDFGKH
INNAFFFGRIKNRHKLFLQKNHQELQKITDLIQKDLEPFGAKKLGLRSSEGKIYSQMMEFLHYIITLTHK
DYPICERDLSQHVKNLKVAFGFNKFQTSFEGQQKFGSIFCIKEYREIPLENIDRCLQLDSELIITEIIIF
TSNNKAVKEFKKQINILQISEDNTLLQNSGINEIIELEKISAMDFCQQKIIVTIFADDKNRLAKNISDLS
SVMSLIGLMMFRTDLHMENHFWAQLPGNFAFVTQPKNILEKYACSFAMLHDFTSGTLKGGRWKEAVTVFF
SKKGSPYFFNFHGKKNNGHTTILGAPNSGRTSLINFLLSESRKFNPRIVILDNTGKSIIFTKAVSGQYYI
IDPKYKDKSLKFNPLNIEDSASNRNMLVELIKRMVADASLVDVEEKTKKIVDSIFAIPRESRSISQISEV
LLLLGGKISKWCGEGEFAYLFQDGDESDIDWGTKTISLNTANLTKQKECMSVILYYFLYSFEAKCDGSPA
ILVLDEAWEISNIFPTEGEFDDWMQRMTKLNVVVILSTENLNLAFASKFTQYLDKHVDTRILMPNINANR
LYMKAFSLSKEELNVILQTPTQEGLFLIKQYKGLVTLNLDLKNMKEIHVLSANKETIKYMYEAIKEKGEK
VSKWLPAFYEKCKA
 
Nucleotide Sequence: 2355 bp     [Download]
>gi|190570478|ref|NC_010981.1|:694193-696547 Wolbachia endosymbiont of Culex quinquefasciatus Pel chromosome, complete genome
ATGCAACCAAAAGTACCAGCCACTAGATCTAATTCTGAAAAAAAGAACAATTTAGCGTTACTAGAAAGTA
TTAATTTAGATTTTATCCCTTATGCTTGCCACTACGATGAAGAAACTATACTAACAAAACAGGGGGAATT
ATTAAAAATAATCAAATTAGAAGACTATTCTTCAGTTGATAACTATGGTGATCTTAGAACTGAAATTAGA
AAAAGTATATCAAAAAATATCAAGAGTTTATATTTTACCGTTTGGATTCACACTGTCCGTAAGCGCAATA
AACTGAGCTTACAGTGGAATAAAACTTCAGACTTTTCCGATCAGCTACACTCAACGTGGTTTAATAAACT
AGTTGATAGTAAACTACAGTATATAAATGAGTTATACATTGTGGTGTTACTTAGTGATTTTGGCAAACAT
ATTAATAATGCATTTTTTTTTGGCAGGATAAAGAATAGGCACAAGTTATTTTTACAAAAAAATCATCAAG
AATTACAAAAAATAACTGACCTGATTCAAAAAGATTTAGAACCTTTTGGAGCTAAAAAACTGGGCCTTAG
GTCTAGTGAAGGCAAAATATATTCTCAAATGATGGAATTTCTCCATTACATTATTACATTAACGCACAAA
GATTATCCAATATGTGAAAGGGATCTATCGCAGCATGTTAAAAATTTAAAAGTAGCTTTTGGTTTCAATA
AATTTCAAACATCGTTTGAAGGTCAACAGAAGTTTGGTTCTATTTTTTGCATAAAGGAATATCGAGAAAT
CCCCTTAGAAAATATAGATAGGTGTTTGCAACTTGACTCTGAGCTTATCATCACAGAAATAATAATATTT
ACTAGTAATAATAAAGCAGTAAAAGAATTCAAAAAACAAATTAATATACTGCAAATCAGTGAGGACAATA
CCTTACTTCAAAACTCAGGAATAAATGAAATAATAGAGCTTGAAAAAATTTCTGCTATGGATTTTTGTCA
ACAGAAAATTATTGTTACAATCTTTGCAGATGATAAGAATAGGTTAGCTAAAAATATCAGTGATTTATCC
TCTGTAATGTCGTTAATCGGGTTGATGATGTTTAGGACTGATCTGCACATGGAAAATCATTTTTGGGCAC
AGCTTCCTGGAAACTTTGCTTTTGTTACACAACCAAAAAATATATTAGAAAAATATGCTTGCAGCTTTGC
TATGTTGCATGATTTTACATCAGGTACGTTAAAAGGAGGAAGATGGAAAGAAGCAGTAACAGTTTTTTTT
TCAAAAAAAGGCAGTCCTTACTTTTTTAACTTTCATGGAAAGAAAAATAATGGTCATACCACAATACTTG
GAGCTCCAAATTCAGGTAGAACCTCACTGATCAATTTCTTACTTTCGGAATCAAGAAAATTTAACCCTAG
GATTGTTATATTGGATAATACTGGAAAATCAATAATATTTACTAAAGCAGTAAGCGGCCAATATTACATA
ATTGATCCAAAATATAAAGATAAAAGTCTAAAATTTAACCCACTGAACATTGAAGATAGTGCTTCTAATC
GCAATATGCTTGTTGAATTGATCAAAAGGATGGTTGCAGATGCAAGTTTGGTAGACGTAGAAGAAAAGAC
AAAAAAAATTGTAGATTCTATATTTGCTATACCAAGAGAATCGCGATCTATTTCTCAAATTTCTGAAGTG
CTTTTACTTCTTGGAGGCAAAATAAGTAAATGGTGTGGTGAAGGTGAATTTGCTTACTTATTCCAAGATG
GTGATGAGTCAGACATTGACTGGGGAACAAAAACTATATCCCTCAATACTGCAAATCTCACTAAGCAAAA
AGAATGTATGTCCGTGATACTTTACTATTTCTTATACTCTTTCGAAGCAAAATGTGATGGCTCACCTGCA
ATACTTGTTTTGGATGAAGCATGGGAGATAAGTAATATTTTTCCTACAGAGGGAGAGTTTGACGACTGGA
TGCAAAGAATGACAAAGTTAAATGTTGTAGTAATTCTAAGTACTGAAAACTTAAACCTAGCATTTGCTAG
CAAGTTTACTCAATATTTAGATAAGCATGTCGATACGAGAATCCTGATGCCGAACATAAATGCAAACAGG
TTATACATGAAAGCATTTTCTCTGTCGAAAGAGGAACTGAATGTTATTTTGCAAACACCAACACAGGAAG
GTTTATTTTTGATAAAGCAATACAAAGGTTTAGTAACTTTAAATCTAGATTTGAAGAATATGAAAGAAAT
ACATGTACTTTCAGCTAATAAAGAGACTATAAAGTATATGTATGAAGCAATAAAGGAAAAAGGCGAAAAA
GTGAGTAAGTGGTTACCGGCGTTCTATGAAAAATGTAAAGCTTAA
 Primer design