SecReT4
Protein ID: 190571270
T4SS name [ID]VirB [485]
Gene symbolvirB9
Locus tagWPa_0871
StrainWolbachia endosymbiont of Culex quinquefasciatus Pel
Repliconchromosome [GenBank: NC_010981] [Browse all T4SS(s) in this replicon]
Location [Strand]941351..942136 [-]
ProductPutative virB9 protein
Component typeVirB9
UniProt IDB3CM60
KEGG IDwpi:WPa_0871
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.2e-60, Aligned region: 29..253
Protein Sequence: 261 a.a.     [Download]
>gi|190571270|ref|YP_001975628.1| Putative virB9 protein [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
MIRVLFVALLFFCGGYALAKQEPRPIAGDNHIKVMNYNPQAIHKYTGFYGYQSSILFEPGEVIESLSMGD
ATGWQLLPQGNRLFIKPIDDIADTNATIITNKRVYYFEFHAEEANGLDDPRLAYEVRFLYPLFNSDEIYS
TSNGDILEQASHTTIPDISDIEVIKKGLNFNYSISHVKGSQSIIPIKVFDDGKFTYLQFNKINSDFPAVF
MVDSAGYESLINFRTVDDYLIIERVSSVFTLRNGSSTVCLFNENIPFKKGK
 
Nucleotide Sequence: 786 bp     [Download]
>gi|190570478|ref|NC_010981.1|:c942136-941351 Wolbachia endosymbiont of Culex quinquefasciatus Pel chromosome, complete genome
ATGATTAGGGTACTCTTTGTTGCACTATTATTTTTTTGTGGTGGTTATGCACTTGCAAAACAGGAACCAA
GACCAATAGCTGGTGATAACCACATAAAGGTAATGAATTATAATCCACAGGCTATACATAAGTACACGGG
CTTTTATGGTTATCAATCCAGCATATTGTTTGAGCCAGGGGAGGTAATAGAGAGTCTTTCAATGGGTGAT
GCAACCGGTTGGCAACTCCTTCCTCAAGGTAATAGATTATTTATTAAGCCTATAGATGATATTGCCGATA
CTAATGCAACTATAATTACCAACAAAAGAGTTTATTATTTCGAGTTTCATGCTGAAGAAGCAAACGGGCT
AGATGATCCAAGGTTAGCATATGAAGTAAGGTTTCTTTATCCACTGTTCAACAGTGATGAAATTTATTCA
ACGAGTAACGGTGATATTCTAGAGCAAGCTAGTCATACCACTATCCCTGATATAAGTGATATTGAGGTTA
TAAAGAAAGGCTTGAATTTTAACTATTCCATCTCGCACGTTAAAGGCAGTCAATCAATAATACCAATTAA
GGTTTTTGATGACGGAAAATTTACATATCTACAATTTAATAAAATAAACTCTGATTTCCCGGCAGTTTTT
ATGGTTGATTCTGCAGGATATGAATCCTTGATAAATTTTCGTACAGTTGATGACTACCTGATAATTGAAA
GAGTAAGCTCGGTATTTACCTTAAGAAACGGATCAAGCACAGTCTGCCTGTTTAATGAAAACATACCTTT
CAAAAAAGGTAAGTGA
 Primer design

Protein ID: 190571632
T4SS name [ID]VirB [485]
Gene symbol-
Locus tagWPa_1256
StrainWolbachia endosymbiont of Culex quinquefasciatus Pel
Repliconchromosome [GenBank: NC_010981] [Browse all T4SS(s) in this replicon]
Location [Strand]1328696..1329490 [+]
Producttype IV secretion system protein VirB9
Component typeVirB9
UniProt IDB3CNI2
KEGG IDwpi:WPa_1256
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 9.3e-51, Aligned region: 31..262
Protein Sequence: 264 a.a.     [Download]
>gi|190571632|ref|YP_001975990.1| type IV secretion system protein VirB9 [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
MMNMCRILLVLALLISGNLNASINNKPISVDSRIKTFVYSPNEVFTVIFSQGYYSYIEFAEGEKVKNIAV
GDASSWKINPYDNKLLVMPFEVSSRTNMIITTTKKRNYIFDLISRPNYDKYPDTDAKKVDHDYSVEKDIS
YVIRFYYPQEEDEFDVDLDEVSLPTQMQYITEKPEKIIQENNTRYNYTYIDEGGNIDIVPIELFDDGYLT
YLKFRNSNKIPQIFIEGESCKRLLFDDYVVIKGVHKKLLMRYEGSEVEVINRSL
 
Nucleotide Sequence: 795 bp     [Download]
>gi|190570478|ref|NC_010981.1|:1328696-1329490 Wolbachia endosymbiont of Culex quinquefasciatus Pel chromosome, complete genome
ATGATGAATATGTGTAGGATATTGTTAGTTTTAGCTTTACTAATAAGTGGCAACTTAAATGCATCTATTA
ATAATAAACCTATTTCTGTAGATAGTAGAATAAAGACTTTTGTATATAGCCCTAATGAGGTGTTTACAGT
AATTTTTAGTCAAGGTTACTATTCTTATATTGAGTTTGCAGAAGGGGAAAAAGTCAAAAATATTGCTGTT
GGTGATGCATCAAGTTGGAAAATTAATCCTTATGATAATAAACTGCTTGTCATGCCATTTGAAGTCAGTA
GTCGCACTAACATGATTATTACGACAACTAAAAAGAGAAATTACATTTTTGATCTAATTTCAAGACCAAA
TTACGATAAATACCCAGATACTGATGCTAAAAAAGTGGATCATGATTATTCCGTTGAAAAGGATATATCT
TACGTAATACGTTTTTATTATCCTCAAGAAGAAGATGAATTTGATGTTGATTTAGATGAGGTTTCTTTAC
CTACTCAAATGCAATACATTACAGAAAAGCCAGAAAAAATAATACAAGAAAATAATACGAGGTACAACTA
TACATATATTGATGAAGGTGGTAACATAGATATAGTTCCAATTGAGTTATTCGATGATGGTTATTTAACC
TATTTAAAGTTTAGAAATAGTAATAAAATTCCTCAGATTTTTATAGAAGGCGAATCCTGTAAAAGGCTGT
TATTTGATGATTATGTTGTAATAAAAGGAGTACATAAAAAGCTATTAATGCGTTATGAAGGTAGTGAAGT
TGAAGTTATAAATAGGTCACTTTAG
 Primer design