SecReT4
Protein ID: 190571577
T4SS name [ID]VirB [485]
Gene symbol-
Locus tagWPa_1197
StrainWolbachia endosymbiont of Culex quinquefasciatus Pel
Repliconchromosome [GenBank: NC_010981] [Browse all T4SS(s) in this replicon]
Location [Strand]1271505..1271840 [-]
Producthypothetical protein
Component typeVirB2
UniProt IDB3CNC3
KEGG IDwpi:WPa_1197
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 8.1e-16, Aligned region: 8..93
Protein Sequence: 111 a.a.     [Download]
>gi|190571577|ref|YP_001975935.1| hypothetical protein WPa_1197 [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
MSYIIKKFFNALCIVLFLSFSDYANAATDIDDTTAQVICNIIGYIWGIGGPLMTVVIIGAALLAIFGRMP
WPALFALGMFCGVFFGAKAIIMKIIPDSIKQDSMLSKCGEK
 
Nucleotide Sequence: 336 bp     [Download]
>gi|190570478|ref|NC_010981.1|:c1271840-1271505 Wolbachia endosymbiont of Culex quinquefasciatus Pel chromosome, complete genome
ATGAGCTATATAATAAAAAAATTTTTTAATGCTTTGTGTATAGTGCTGTTTCTCTCTTTTTCAGATTACG
CAAATGCTGCTACTGATATAGATGATACAACTGCCCAAGTAATATGCAATATTATTGGTTATATTTGGGG
AATAGGTGGGCCACTTATGACTGTAGTCATAATAGGTGCAGCTTTGCTTGCAATATTTGGTAGAATGCCA
TGGCCAGCTCTCTTTGCCCTAGGTATGTTTTGTGGTGTATTTTTTGGTGCCAAAGCGATTATAATGAAAA
TTATACCCGATAGCATTAAACAAGATAGTATGTTGAGCAAGTGTGGGGAAAAATAA
 Primer design

Protein ID: 190571648
T4SS name [ID]VirB [485]
Gene symbol-
Locus tagWPa_1273
StrainWolbachia endosymbiont of Culex quinquefasciatus Pel
Repliconchromosome [GenBank: NC_010981] [Browse all T4SS(s) in this replicon]
Location [Strand]1348472..1348828 [+]
Producthypothetical protein
Component typeVirB2
UniProt IDB3CNS4
KEGG IDwpi:WPa_1273
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 7.3e-18, Aligned region: 5..93
Protein Sequence: 118 a.a.     [Download]
>gi|190571648|ref|YP_001976006.1| hypothetical protein WPa_1273 [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
MNPTIRKVFCILLIVLFISFSHVGSAANSNDDTTAQVICNIIGYVWGIGGPLMTVVIIGAALLAIFGRMP
WPALFALGVFCAVFFGAKTIVIKVMGGINSTNASFMEECGTGDKKKSQ
 
Nucleotide Sequence: 357 bp     [Download]
>gi|190570478|ref|NC_010981.1|:1348472-1348828 Wolbachia endosymbiont of Culex quinquefasciatus Pel chromosome, complete genome
ATGAACCCTACAATTAGAAAGGTTTTTTGTATTCTACTTATAGTATTATTTATTTCTTTTTCTCATGTTG
GAAGTGCTGCTAACTCTAATGACGATACAACTGCTCAAGTAATATGTAATATTATTGGCTACGTTTGGGG
AATAGGTGGACCGCTTATGACCGTAGTGATAATAGGAGCAGCTTTACTTGCAATATTTGGTAGAATGCCG
TGGCCTGCTCTTTTCGCCCTCGGTGTATTTTGCGCTGTGTTTTTTGGCGCTAAAACTATTGTCATAAAAG
TAATGGGTGGTATAAACTCTACAAATGCCTCTTTTATGGAAGAATGTGGAACGGGAGATAAAAAAAAGAG
TCAATAG
 Primer design