SecReT4
Protein ID: 190571633
T4SS name [ID]VirB [485]
Gene symbol-
Locus tagWPa_1257
StrainWolbachia endosymbiont of Culex quinquefasciatus Pel
Repliconchromosome [GenBank: NC_010981] [Browse all T4SS(s) in this replicon]
Location [Strand]1329507..1331018 [+]
Producttype IV secretion system protein VirB10
Component typeVirB10
UniProt IDB3CNI3
KEGG IDwpi:WPa_1257
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 5.3e-41, Aligned region: 205..330
TrbI [PF03743], Evalue: 5.3e-41, Aligned region: 443..495
Protein Sequence: 503 a.a.     [Download]
>gi|190571633|ref|YP_001975991.1| type IV secretion system protein VirB10 [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
MSKERHNSVEDESEIESKVVTVGSNQGYKALMIVMVALLVGGVYYLYFSPSNKEGPEIVKKEETKQNIQE
LKGKLEQVPDNVVVSERIATDLLPPLPPLPIPQVIPEVKQIKKEEVTKKEEQLKEIPLSNIPVLPKQNFP
SGNVISNLPTSFPTIGGGGYPRDRRSAQMLAISGSSGEGKATDAVLSNTSAQSSKATKAGKLGLMIIQGK
VIDAILETAISSDLKGMLRAVVSRDVYAETGDTILIPKGSRLIGGYSFDSNVAKARVNINWNRIILPHGI
DVAIASSGTDELGRAGIAGIVDNKIASALFSSVALAGVSIGSAVVGQKASNLIDALTAMDAVKSITATEI
DISSLKGAIVERLENSIKTEVGKVGDEKWKLGIRAIEKIRNAKSDQDLLRIIKEEIVSVIKSSGASGVDT
ITSDNIGITLDDVRQLLRQTQKRSKSVYDEAIGKSINDFSKDMRDIVDRSVDKKPTIYVNQGTALKVFVN
QDIVFPPQSILNN
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|190570478|ref|NC_010981.1|:1329507-1331018 Wolbachia endosymbiont of Culex quinquefasciatus Pel chromosome, complete genome
ATGAGTAAAGAAAGGCATAATAGTGTAGAAGATGAATCAGAGATAGAAAGCAAGGTAGTAACAGTTGGCT
CTAATCAAGGTTATAAGGCATTGATGATAGTTATGGTAGCGCTCTTAGTTGGTGGAGTGTACTATCTTTA
TTTTAGTCCTTCTAATAAAGAGGGTCCAGAGATTGTTAAAAAAGAGGAAACAAAGCAAAACATTCAAGAA
TTGAAAGGAAAGTTAGAACAAGTTCCAGATAATGTAGTAGTTTCCGAGAGGATAGCAACTGATCTCTTGC
CACCCTTACCTCCTCTTCCTATCCCACAAGTCATACCAGAAGTAAAACAAATCAAAAAAGAGGAAGTGAC
AAAAAAAGAAGAGCAACTAAAAGAAATTCCCTTGTCAAATATACCTGTTTTACCAAAGCAAAATTTTCCT
TCTGGTAATGTTATTAGCAATTTGCCTACTTCATTTCCTACAATAGGGGGTGGCGGTTATCCTAGAGACA
GACGTAGTGCACAAATGTTAGCAATTTCAGGTAGTAGTGGGGAAGGTAAAGCTACAGATGCTGTTTTATC
CAATACCTCAGCACAGTCGAGCAAAGCTACCAAAGCTGGAAAGCTTGGTTTAATGATTATTCAAGGTAAA
GTTATTGACGCTATTCTTGAAACTGCAATAAGTTCTGACTTAAAAGGAATGCTCCGTGCTGTTGTTAGTA
GAGACGTTTATGCAGAAACTGGTGATACAATTTTAATACCAAAAGGTTCAAGGTTAATAGGTGGTTATTC
ATTCGACTCAAATGTTGCAAAAGCCCGCGTGAACATAAATTGGAATAGGATCATTCTTCCTCATGGTATA
GATGTTGCTATTGCATCATCTGGTACCGATGAGCTTGGAAGGGCAGGGATAGCTGGAATAGTTGATAATA
AAATAGCAAGTGCATTATTCTCTTCAGTGGCACTTGCTGGTGTTTCGATTGGTTCAGCTGTTGTAGGACA
AAAAGCCTCTAATCTTATCGATGCGCTAACTGCCATGGATGCAGTGAAGTCTATTACTGCAACTGAAATA
GATATTTCTTCTCTCAAAGGGGCTATTGTTGAGAGATTGGAGAATTCTATAAAAACTGAAGTTGGGAAGG
TAGGAGACGAAAAATGGAAATTGGGTATTAGGGCTATTGAAAAAATTCGAAATGCTAAAAGTGATCAGGA
TTTGCTGAGAATAATAAAGGAAGAAATAGTAAGTGTGATAAAAAGTTCTGGAGCTAGTGGAGTTGATACA
ATTACTAGTGACAATATCGGTATAACTTTAGACGATGTACGTCAACTGTTGAGGCAAACTCAGAAAAGAA
GCAAATCTGTTTATGATGAAGCAATCGGGAAGTCAATCAATGATTTTTCCAAAGACATGCGAGATATAGT
TGATAGGAGTGTAGATAAAAAACCAACTATTTATGTTAATCAAGGAACTGCATTGAAAGTATTTGTTAAC
CAAGATATAGTATTTCCTCCACAGTCAATATTAAATAACTGA
 Primer design