SecReT4
Protein ID: 190571634
T4SS name [ID]VirB [485]
Gene symbol-
Locus tagWPa_1258
StrainWolbachia endosymbiont of Culex quinquefasciatus Pel
Repliconchromosome [GenBank: NC_010981] [Browse all T4SS(s) in this replicon]
Location [Strand]1331020..1332012 [+]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDB3CNI4
KEGG IDwpi:WPa_1258
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.4e-88, Aligned region: 11..310
Protein Sequence: 330 a.a.     [Download]
>gi|190571634|ref|YP_001975992.1| type IV secretion system ATPase VirB11 [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
MNYAALDTYLEPLQGIFQEEGVNEISINKPKEVWIENRGEIRCEKLEIFDLNHLKSLSRLIAQATEQKLS
EETPLLSATLPNGYRIQIVFPPACEPDKVVISIRKPSSMQLALDDYEKMGAFSETVIGVTDNPVDRHLDL
LLKQKKIKEFLEYAVISKKNIIISGGTSTGKTTFTNATLRAIPSEERIITVEDAREIVLNDHPNRVHLIA
SKGGQGRAKVTTQDLIEACLRLRPDRIIVGELRGAEAFSFLRAINTGHPGSISTLHADSPAMALEQIKLM
VMQANLGIPPDQIIPYIRNVIDIVIQLKRTSGGKRSISEILFTRSSNENT
 
Nucleotide Sequence: 993 bp     [Download]
>gi|190570478|ref|NC_010981.1|:1331020-1332012 Wolbachia endosymbiont of Culex quinquefasciatus Pel chromosome, complete genome
ATGAACTATGCTGCACTTGATACATACTTGGAGCCATTACAAGGGATATTTCAAGAGGAAGGTGTAAATG
AAATATCAATAAATAAACCGAAGGAAGTATGGATTGAAAATCGCGGTGAAATAAGATGCGAAAAGTTAGA
AATATTTGATCTTAATCATTTAAAATCTCTTAGCAGGTTGATTGCTCAAGCTACAGAACAAAAACTGAGC
GAAGAGACACCGCTGCTTTCAGCTACATTACCAAATGGTTATCGTATACAGATAGTGTTTCCTCCAGCAT
GTGAGCCTGATAAAGTAGTCATTTCAATTCGTAAACCTTCTTCTATGCAATTGGCATTGGATGATTATGA
AAAAATGGGGGCTTTTTCTGAAACTGTTATAGGAGTGACCGATAATCCAGTAGATCGTCACCTAGATTTG
CTACTGAAACAAAAAAAAATAAAAGAGTTTTTAGAATATGCTGTAATAAGTAAGAAAAATATCATAATTA
GTGGTGGAACTTCCACTGGTAAAACCACTTTTACTAATGCTACTTTGCGTGCTATTCCATCTGAAGAAAG
AATTATTACTGTTGAAGATGCAAGAGAGATAGTTTTGAATGATCATCCGAATAGAGTACATCTTATTGCT
TCTAAAGGAGGTCAGGGTAGGGCAAAAGTGACCACTCAAGATTTGATAGAGGCATGTTTACGTTTAAGAC
CAGATAGAATAATAGTTGGTGAGCTGCGTGGAGCAGAAGCTTTTAGTTTTCTTAGAGCAATAAACACTGG
CCACCCAGGGTCAATATCAACTCTTCATGCGGATAGTCCGGCAATGGCTCTTGAGCAAATAAAACTTATG
GTTATGCAAGCAAATCTTGGAATTCCCCCAGATCAGATCATACCATACATTAGAAATGTAATTGACATTG
TTATTCAACTCAAAAGGACCAGTGGTGGAAAAAGAAGCATTTCTGAAATATTATTTACTAGATCTTCAAA
TGAAAATACTTAA
 Primer design