SecReT4
Protein ID: 190571635
T4SS name [ID]VirB [485]
Gene symbol-
Locus tagWPa_1259
StrainWolbachia endosymbiont of Culex quinquefasciatus Pel
Repliconchromosome [GenBank: NC_010981] [Browse all T4SS(s) in this replicon]
Location [Strand]1332043..1334061 [+]
Producttype IV secretion system protein VirB8
Component typeVirD4
UniProt IDB3CNR0
KEGG IDwpi:WPa_1259
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 7.3e-153, Aligned region: 123..566
TraG-D_C [PF12696], Evalue: 4.5e-27, Aligned region: 406..528
TrwB_AAD_bind [PF10412], Evalue: 2.2e-26, Aligned region: 239..542
AAA_10 [PF12846], Evalue: 2.6e-05, Aligned region: 374..482
Protein Sequence: 672 a.a.     [Download]
>gi|190571635|ref|YP_001975993.1| type IV secretion system protein VirB8 [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
MSNGNHLRNILIGGVVSFSILEFCFYLSGILFYLFVDGPDGVDFRAINPSLTPFPQALWPTIFDHIQYCW
HHPELYSFELKIKLVVSSVLPKIVLMIILWNVRERLIEWRPFKKKESLHGDSQWASEKDIRKAGLRSKKG
LLLGKDKRGYFIADGFQHALLFAPTGSGKGVGFVIPNLLFWNDSVIVHDIKLENYEITSGWRERQGQKVY
VWNPAQPDGVSHCYNPLEWISEKPGQMVDDVQKIANLIMPEQDFWQNEARSLFVGVVLYLLAAPEKVKSF
GEVVRTMRSDDVVYNLAVVLDTMGKIIHPVAYMNIAAFLQKADKERSGVVSTMNSSLELWANPLIDTATA
SSDFNILDFKKKKTTVYVGLTPDNLTRLRPLMQVFYQQATEFLCRKLPSDDEPYGVLFLMDEFPTLGKME
QFQTGIAYFRGYRVRLFLIVQDTEQLKGIYEEAGMNSFLSNSTYRITFAANNIETANLISQLIGNKTVQQ
ESLNKPKFLDLNPASRSLHISETQRALLLPQEIIMLPRDDQIILIESTYPIKSKKILYYSDSTFTRRLIK
PTRVPTQEPYDPNKVFSAANKDKISNEEESNAIEAADYPVEARTEDAIYDEPEIEDGFEDEDIDDKFEGG
DGFDDEEDDDGFDDEDSKDEFDDDDEFEDEDKLDGNKIEDRG
 
Nucleotide Sequence: 2019 bp     [Download]
>gi|190570478|ref|NC_010981.1|:1332043-1334061 Wolbachia endosymbiont of Culex quinquefasciatus Pel chromosome, complete genome
ATGAGTAATGGAAATCACCTACGCAATATTCTCATAGGAGGTGTAGTATCTTTTAGCATACTTGAATTTT
GCTTCTATTTGTCTGGTATATTATTCTACCTGTTTGTTGACGGTCCAGATGGTGTAGATTTTAGAGCAAT
TAATCCTAGCTTGACACCTTTTCCTCAAGCTCTCTGGCCGACAATTTTTGATCATATACAATATTGTTGG
CATCATCCAGAGCTATATAGCTTTGAGCTCAAAATTAAATTAGTTGTATCTTCTGTACTGCCTAAAATTG
TTTTGATGATTATTTTGTGGAATGTGAGAGAAAGACTAATTGAGTGGCGGCCATTTAAAAAGAAAGAATC
ACTTCATGGAGATTCACAGTGGGCATCAGAGAAAGACATACGAAAAGCGGGATTAAGAAGCAAAAAAGGT
CTATTGCTTGGTAAAGATAAGAGAGGATATTTTATTGCTGATGGGTTTCAGCATGCATTGCTCTTTGCAC
CTACAGGCTCTGGTAAAGGTGTTGGTTTTGTAATTCCTAATTTGTTATTTTGGAATGATTCGGTAATTGT
GCATGATATAAAATTAGAAAACTATGAAATAACAAGTGGTTGGCGAGAGCGACAAGGACAAAAAGTATAT
GTATGGAACCCAGCGCAGCCAGATGGGGTAAGCCATTGTTATAATCCACTGGAATGGATTAGTGAAAAAC
CTGGACAGATGGTTGACGATGTGCAAAAAATAGCTAACCTAATCATGCCTGAACAAGATTTTTGGCAAAA
CGAAGCAAGAAGCTTATTTGTTGGGGTGGTACTATATTTACTTGCTGCACCAGAGAAAGTTAAATCTTTT
GGTGAGGTTGTGCGTACGATGCGTAGCGATGACGTAGTTTACAATCTTGCTGTAGTTTTGGACACAATGG
GTAAAATAATACATCCGGTAGCGTATATGAACATTGCAGCTTTTTTGCAAAAGGCTGACAAAGAAAGATC
AGGTGTTGTGTCAACTATGAACTCGTCGCTTGAATTGTGGGCAAACCCATTGATCGATACTGCAACTGCA
TCAAGTGATTTTAATATTTTGGATTTTAAAAAGAAGAAAACTACAGTTTATGTTGGTTTAACTCCTGATA
ACTTAACTAGGCTCAGGCCTTTAATGCAGGTTTTTTACCAACAGGCAACTGAGTTTTTATGTAGAAAATT
GCCATCGGATGACGAGCCTTACGGCGTATTATTTTTAATGGATGAGTTTCCAACACTTGGAAAAATGGAG
CAATTTCAAACGGGCATCGCATACTTTCGTGGCTATCGAGTAAGGTTATTTTTAATTGTTCAAGATACTG
AACAGCTTAAAGGAATATATGAAGAAGCAGGAATGAACTCCTTTTTATCAAACTCAACCTATAGAATAAC
TTTTGCAGCCAATAATATTGAAACGGCTAATTTGATATCTCAGCTTATAGGAAACAAAACTGTACAACAA
GAATCATTAAACAAACCTAAATTTTTAGACTTGAATCCTGCATCAAGATCATTGCATATCTCTGAAACAC
AGAGAGCATTGCTCTTACCTCAAGAAATTATTATGCTGCCACGTGATGATCAGATAATTTTGATAGAATC
GACTTATCCAATTAAGTCAAAGAAAATTTTGTACTATAGTGATAGCACATTCACAAGAAGGCTGATTAAA
CCAACACGTGTGCCTACACAAGAGCCATATGATCCAAACAAGGTCTTTTCTGCTGCTAACAAAGATAAGA
TTAGTAATGAAGAAGAGAGTAATGCTATTGAAGCTGCTGATTATCCTGTTGAAGCTAGAACTGAAGATGC
AATATACGATGAGCCAGAGATTGAAGATGGATTTGAAGACGAGGATATTGATGATAAGTTTGAAGGTGGT
GATGGGTTTGATGATGAGGAAGACGATGATGGGTTTGATGATGAAGACAGTAAGGATGAATTTGACGATG
ATGATGAATTTGAAGATGAGGACAAACTAGACGGCAATAAAATCGAGGATAGAGGTTAA
 Primer design