SecReT4
Protein ID: 190571948
T4SS name [ID]Trb [58]
Gene symboltrbC
Locus tagpCNB_p28
StrainComamonas testosteroni CNB-1
Repliconplasmid pCNB [GenBank: NC_010935] [Browse all T4SS(s) in this replicon]
Location [Strand]20868..21332 [+]
ProductTrbC
Component typeTrbC
UniProt IDA7K7I4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4e-18, Aligned region: 17..110
Protein Sequence: 154 a.a.     [Download]
>gi|190571948|ref|YP_001967672.1| TrbC [Comamonas testosteroni CNB-1]
MQSTLPAFRFDSRAVFYLGMFALLAFFLLAPQHAFASEGTGGSLPYEGWLTNLRNSVTGPVAFALSIIGI
VVAGGILIFGGELNGFFRTLIFIVLVMALLVGAQNMMSTFFGRGAEIAALTDGVLHQAKVAALDMAGFPG
EAIARWAERGHIAG
 
Nucleotide Sequence: 465 bp     [Download]
>gi|190571920|ref|NC_010935.1|:20868-21332 Comamonas testosteroni CNB-1 plasmid pCNB, complete sequence
ATGCAATCGACCCTTCCCGCGTTCCGCTTCGACAGCCGCGCCGTGTTCTACCTGGGCATGTTCGCCCTCT
TGGCGTTCTTCCTGCTGGCCCCCCAGCACGCTTTCGCCTCCGAAGGCACCGGCGGTTCCCTGCCGTATGA
AGGCTGGTTGACCAACCTGCGCAACAGCGTCACCGGCCCGGTGGCCTTCGCGCTGTCGATCATCGGCATC
GTTGTCGCCGGCGGCATCTTGATCTTCGGCGGCGAACTCAACGGCTTCTTCCGCACGTTGATCTTCATCG
TCCTGGTCATGGCCCTGCTGGTCGGCGCGCAGAACATGATGAGCACCTTCTTCGGCCGTGGCGCGGAAAT
CGCCGCCCTGACCGATGGCGTGCTGCACCAGGCCAAGGTCGCGGCGCTGGACATGGCCGGCTTCCCTGGT
GAAGCCATCGCACGCTGGGCCGAACGCGGCCACATCGCGGGGTAA
 Primer design