SecReT4
Protein ID: 190571952
T4SS name [ID]Trb [58]
Gene symboltrbG
Locus tagpCNB_p32
StrainComamonas testosteroni CNB-1
Repliconplasmid pCNB [GenBank: NC_010935] [Browse all T4SS(s) in this replicon]
Location [Strand]24984..25898 [+]
ProductTrbG
Component typeTrbG
UniProt IDA7K7I8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.1e-64, Aligned region: 79..303
Protein Sequence: 304 a.a.     [Download]
>gi|190571952|ref|YP_001967676.1| TrbG [Comamonas testosteroni CNB-1]
MNPRTFTMKKIFSVVALGAALLSPTLALAADDLADKYFTGKNPTLTPQERAAIDIAKRWNAGAATGMKPV
AGSNGAIKFLFGAQQPSIVCAVLQVCDVALQPGEQVNSINLGDTARWTVEPAITGSGPNEVQHLIIKPMD
VGLETSLIVTTNRRAYHLRLRSHRTEYMPQVSFTYPEDALAKWDAIQRRETQERTDRTIPQTGEYLGDLK
FDYDLSGSASWKPVRVFNDGRKTIIEMPGTMEQTEAPTLLVVRREGGIFRDEETVMVNYRVQGNRYIVDT
VFDRAILIAGVGGSQDRVTISRRK
 
Nucleotide Sequence: 915 bp     [Download]
>gi|190571920|ref|NC_010935.1|:24984-25898 Comamonas testosteroni CNB-1 plasmid pCNB, complete sequence
ATGAACCCAAGGACATTCACCATGAAGAAAATCTTTTCCGTTGTCGCCTTGGGCGCTGCGCTGCTGTCGC
CCACCCTGGCCCTGGCCGCCGATGACCTGGCCGACAAGTATTTCACCGGCAAGAACCCGACGCTGACGCC
TCAAGAGCGCGCGGCCATCGACATTGCGAAGCGATGGAACGCGGGCGCTGCCACCGGCATGAAGCCCGTC
GCCGGCTCCAATGGCGCGATCAAGTTCCTGTTCGGCGCGCAGCAGCCCAGCATCGTGTGCGCGGTGCTCC
AGGTGTGCGACGTGGCCTTGCAGCCAGGCGAGCAAGTCAACTCGATCAACCTGGGCGACACGGCCCGGTG
GACGGTCGAGCCGGCCATCACCGGCAGCGGCCCCAACGAAGTGCAGCACCTCATCATCAAGCCGATGGAT
GTTGGCCTGGAAACCAGCCTCATCGTGACGACGAACCGCCGCGCCTATCACCTGCGCCTGCGCTCGCATC
GCACCGAGTACATGCCGCAAGTCTCGTTCACCTACCCCGAGGACGCGCTTGCGAAGTGGGACGCGATCCA
GCGCCGCGAAACGCAAGAACGCACCGACCGCACCATCCCGCAGACCGGCGAGTACCTGGGCGATCTCAAG
TTCGACTATGACCTGTCCGGCTCGGCGAGCTGGAAGCCGGTGCGTGTGTTCAACGATGGCCGCAAGACCA
TCATCGAAATGCCCGGAACGATGGAGCAAACCGAAGCGCCGACGCTCCTGGTCGTGCGCCGCGAGGGCGG
CATCTTCCGCGACGAGGAAACCGTGATGGTGAACTATCGCGTGCAGGGCAATCGCTACATCGTGGACACG
GTGTTTGACCGCGCGATCCTGATTGCCGGTGTTGGTGGAAGCCAAGACCGCGTGACTATCTCCCGGAGGA
AGTGA
 Primer design