SecReT4
Protein ID: 190571957
T4SS name [ID]Trb [58]
Gene symboltrbL
Locus tagpCNB_p37
StrainComamonas testosteroni CNB-1
Repliconplasmid pCNB [GenBank: NC_010935] [Browse all T4SS(s) in this replicon]
Location [Strand]28778..30496 [+]
ProductTrbL
Component typeTrbL
UniProt IDA7K7J3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 5.8e-40, Aligned region: 64..278
Protein Sequence: 572 a.a.     [Download]
>gi|190571957|ref|YP_001967681.1| TrbL [Comamonas testosteroni CNB-1]
MRMPASLKLALPLLVWLAFFSTDASAQMNSSGLFDDVLNRYNAAASGWAGVITNAASWLFWLLVTISMVW
TFGMMALRKADIGEFFAELVRFTIFTGFFWWLLTNGPNFASTIYASLRQIAGNATGLGQALSPSGIVDIG
FAIFYKVMDQSSVWSPVDSMAGILMAVAILIVLALIGVNMLLLLASGWVLAYGGVFFLGFGGSRWTSDMA
INYYKTVLGVAAQLMAMVLLVGIGKTFLDDYYARMSEGINLKEMGVMLIVCVILLALVNKIPALIAGVIT
GASVGGAGIGNFGAGAALGAAGMAAAAAATGGAALAAGAASAAGGASAVMAAFSKANENVSSGSDVMSML
GGGGGGDSGGGGGGEAGTSTPLGQAAGFGGGGGDSGGGGSSGGESKGGDKGGDKAGGDKAGSSSKGGEGG
GQKASGGGDAGGAKAGQGGGQGQGAGQGGQQDAPGSTGPGMLASAASALGKAGRVTADAGANLAKGVGAV
AAAKAASMRDSAMERIADTTGGKIAAAIKAQGGSSADTSIDVPDQQPSPTFGDNSLAGADSSADPESEVA
AFRDGGRNDKSA
 
Nucleotide Sequence: 1719 bp     [Download]
>gi|190571920|ref|NC_010935.1|:28778-30496 Comamonas testosteroni CNB-1 plasmid pCNB, complete sequence
ATGAGAATGCCAGCCAGCTTGAAACTCGCCCTGCCGCTGCTCGTTTGGCTGGCGTTCTTTTCTACGGACG
CTTCCGCCCAAATGAACAGCTCGGGCCTCTTCGATGACGTTCTGAACCGCTACAACGCCGCCGCCAGCGG
CTGGGCCGGTGTCATCACCAACGCCGCATCCTGGTTGTTCTGGCTGCTGGTGACGATCTCGATGGTCTGG
ACGTTCGGCATGATGGCCTTGCGCAAGGCCGACATTGGGGAGTTCTTCGCGGAGCTTGTCCGCTTCACCA
TCTTCACCGGCTTCTTCTGGTGGTTGCTGACGAACGGCCCTAACTTCGCCTCGACCATCTATGCGTCGCT
ACGCCAAATTGCCGGCAACGCGACGGGCTTGGGTCAAGCCTTGTCGCCTTCCGGCATTGTCGATATTGGC
TTTGCCATCTTCTACAAGGTGATGGATCAGTCCTCGGTGTGGTCGCCGGTGGACAGCATGGCCGGCATCC
TCATGGCCGTTGCCATCTTGATCGTGCTCGCGCTCATCGGCGTGAACATGCTTCTTCTCCTGGCGTCTGG
TTGGGTGCTCGCCTATGGCGGCGTGTTCTTCCTCGGCTTCGGTGGGTCGCGGTGGACTTCCGACATGGCG
ATCAACTACTACAAGACCGTGCTGGGTGTGGCCGCGCAGCTCATGGCAATGGTGCTGCTGGTCGGCATCG
GCAAGACCTTTCTGGATGACTACTACGCGCGCATGAGCGAGGGGATCAACCTCAAGGAAATGGGCGTGAT
GCTCATCGTCTGCGTGATCCTGCTGGCACTCGTCAACAAGATTCCGGCGCTCATCGCCGGCGTCATCACC
GGCGCGAGCGTGGGCGGTGCCGGCATCGGCAACTTCGGCGCAGGCGCGGCCCTCGGTGCCGCTGGCATGG
CGGCCGCAGCAGCGGCAACCGGCGGCGCTGCTCTGGCGGCCGGCGCGGCCTCGGCCGCCGGCGGTGCTTC
TGCGGTCATGGCCGCGTTCTCGAAGGCCAATGAAAACGTCTCGTCCGGGTCGGATGTCATGTCCATGCTG
GGCGGTGGTGGTGGCGGCGACTCTGGCGGTGGTGGTGGCGGTGAAGCCGGCACCAGCACGCCCCTGGGCC
AAGCCGCCGGCTTCGGTGGCGGCGGTGGCGACTCTGGCGGCGGCGGCAGCAGCGGCGGCGAGTCGAAGGG
CGGCGACAAAGGCGGCGACAAGGCCGGCGGCGATAAGGCCGGCTCCAGCTCGAAGGGTGGCGAAGGCGGC
GGCCAGAAGGCCAGCGGCGGCGGTGACGCCGGCGGCGCGAAGGCCGGCCAGGGTGGCGGCCAGGGCCAGG
GAGCGGGGCAGGGCGGCCAGCAGGACGCACCTGGTAGTACCGGCCCCGGCATGCTGGCCTCGGCCGCTTC
CGCGCTTGGCAAGGCCGGCCGCGTCACGGCCGACGCCGGCGCGAACTTGGCGAAGGGTGTAGGTGCGGTG
GCGGCCGCGAAGGCCGCCAGCATGCGCGACTCGGCGATGGAACGCATCGCCGACACCACCGGCGGAAAGA
TCGCGGCCGCGATCAAGGCGCAGGGCGGCAGCTCGGCCGACACGAGCATCGACGTGCCCGATCAACAACC
CTCGCCGACCTTCGGCGACAACAGCCTGGCCGGAGCTGACAGCTCTGCCGATCCCGAGTCCGAAGTAGCC
GCGTTCCGTGACGGCGGCCGCAACGACAAATCTGCGTAA
 Primer design