SecReT4
Protein ID: 190573300
T4SS name [ID]Trb [285]
Gene symboltrbI
Locus tagSmlt1283
StrainStenotrophomonas maltophilia K279a
Repliconchromosome [GenBank: NC_010943] [Browse all T4SS(s) in this replicon]
Location [Strand]1324734..1325993 [-]
Productconjugal transfer protein
Component typeTrbI
UniProt IDB2FTD5
KEGG IDsml:Smlt1283
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.9e-59, Aligned region: 223..405
Protein Sequence: 419 a.a.     [Download]
>gi|190573300|ref|YP_001971145.1| conjugal transfer protein [Stenotrophomonas maltophilia K279a]
MHDDDSPDLATSSAGKVAPEAVVLRAQPRPVTRLNRRTLAILTGGLSVAVLGATIWALQPHRRGAGWQNE
LYNVDRVSKSEGLDGLPSDYSKLPKVPELGPPLPGDLGPAIVAAQQPAYMPPGHDPNDALRKEAEAAAAS
AVFFRSGQQGKAAASGAAQVAAASPGSALAGFDPLAAGPASTAAQPSDPTAVQNRQDQKEAFLKGGSTET
RNSGHLQMPASPYQVMAGTVIAAALVTGIKSDLPGDVIATVTEPVYDSATGRFLLIPQGSRILGKYNSQV
SFGQSRVQMVWNRIILPDTSSLTLDNLVGTDPAGYAGLEDDVDRHWGRIFAGAALTTLLGIGAELAAPEN
RQNGNRIVIAGRDGLQDSVNQVGQEMTRRNMNIQPTLTARPGLPVRLIVSRDLALRPYQPMLYQFGRSQ
 
Nucleotide Sequence: 1260 bp     [Download]
>gi|190572091|ref|NC_010943.1|:c1325993-1324734 Stenotrophomonas maltophilia K279a chromosome, complete genome
ATGCACGACGATGACTCCCCCGACCTTGCCACATCTTCGGCGGGCAAGGTGGCACCCGAGGCGGTGGTGC
TGCGCGCCCAGCCTCGCCCGGTCACGCGCCTGAACCGGCGCACCTTGGCCATCCTCACCGGCGGCCTGTC
GGTCGCCGTGCTCGGGGCCACGATCTGGGCATTGCAGCCGCACCGGCGCGGCGCGGGATGGCAGAACGAG
CTGTACAACGTGGATCGTGTCTCGAAGTCCGAGGGGCTGGATGGGTTGCCGTCCGATTACTCGAAACTGC
CCAAGGTGCCCGAGCTGGGGCCGCCGCTGCCGGGCGACCTGGGGCCGGCCATCGTGGCGGCGCAGCAGCC
GGCCTACATGCCGCCGGGCCACGATCCCAACGATGCCTTGCGCAAGGAGGCCGAAGCGGCGGCGGCTTCG
GCGGTTTTCTTTCGCTCGGGCCAGCAGGGCAAGGCCGCAGCGTCTGGCGCGGCCCAAGTCGCTGCGGCTT
CGCCCGGCAGCGCCTTGGCGGGCTTCGATCCGCTGGCGGCCGGGCCGGCCTCGACGGCGGCCCAGCCATC
CGACCCGACCGCTGTGCAGAACCGGCAAGACCAAAAAGAGGCTTTCCTGAAAGGCGGCTCTACGGAAACC
CGCAATTCCGGCCATCTCCAGATGCCGGCTTCGCCGTACCAGGTGATGGCCGGGACGGTGATCGCGGCGG
CGCTGGTCACAGGCATCAAGTCCGACCTGCCGGGCGATGTGATCGCTACGGTGACGGAGCCGGTCTACGA
CTCTGCCACGGGGCGCTTCCTGCTGATCCCGCAGGGCTCGCGCATCTTGGGCAAGTACAACAGCCAGGTG
AGCTTTGGGCAGAGCCGGGTGCAGATGGTGTGGAACCGGATCATCCTGCCGGATACGTCCTCGCTGACAC
TCGACAACCTGGTGGGCACCGATCCCGCGGGTTACGCGGGGCTGGAGGATGATGTGGATCGGCACTGGGG
CCGCATCTTCGCTGGGGCGGCGCTGACCACGCTGCTGGGCATCGGCGCCGAACTGGCCGCACCGGAGAAC
CGGCAGAACGGCAACCGCATCGTCATTGCCGGGCGCGATGGTCTGCAGGACAGTGTGAACCAGGTGGGGC
AGGAGATGACCCGGCGCAACATGAACATCCAGCCGACGTTGACAGCGCGGCCGGGCTTGCCGGTTCGCCT
GATCGTCTCGCGCGATCTTGCATTGCGTCCCTACCAGCCGATGCTCTATCAGTTTGGGAGATCTCAATGA
 Primer design