SecReT4
Protein ID: 190573301
T4SS name [ID]Trb [285]
Gene symboltrbG
Locus tagSmlt1284
StrainStenotrophomonas maltophilia K279a
Repliconchromosome [GenBank: NC_010943] [Browse all T4SS(s) in this replicon]
Location [Strand]1325996..1326982 [-]
Productconjugal transfer protein
Component typeTrbG
UniProt IDB2FTD6
KEGG IDsml:Smlt1284
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.8e-66, Aligned region: 102..321
Protein Sequence: 328 a.a.     [Download]
>gi|190573301|ref|YP_001971146.1| conjugal transfer protein [Stenotrophomonas maltophilia K279a]
MNDLFRKSVLPIMLLALAGCATQGKPPPAISLDEPVQAQTLPDVPKPVEVVGVPEPLALPGQMKPLPGGD
AKSAPEPADEKTRVTRANTEARIAPTREGYVNAIQVWPFTDGALYQVYAAVGRVTVVALQPGEELVTVAA
GDTVRWIVGDTSSGSGADLRVSVMVKPIRSGLKTNLVITTSRRTYLLELTSTEKTWMASVSWEYPKDRML
ALQRQAQAASAAAPVDAGLSLEKIRFRYAISGSNPPWKPERVFDDGQKVYVQFPSGIAQGELPPLFVIGA
QGDGQLVNYRFRSPYLIVDRLFGAAELRLGGAKGDVVRIERTDGAKGK
 
Nucleotide Sequence: 987 bp     [Download]
>gi|190572091|ref|NC_010943.1|:c1326982-1325996 Stenotrophomonas maltophilia K279a chromosome, complete genome
ATGAATGATCTTTTCCGTAAATCCGTCTTGCCGATCATGTTGCTTGCCCTCGCGGGCTGCGCCACGCAGG
GCAAGCCGCCGCCAGCCATCTCGCTCGACGAGCCGGTGCAGGCTCAGACGCTGCCCGATGTGCCGAAACC
GGTTGAGGTGGTCGGCGTGCCCGAGCCGCTGGCATTGCCCGGTCAGATGAAGCCATTACCCGGTGGCGAT
GCAAAGTCTGCACCGGAGCCTGCCGACGAGAAGACGCGCGTGACCCGCGCCAACACAGAGGCGCGTATCG
CGCCGACGCGCGAGGGCTATGTGAACGCCATCCAGGTCTGGCCGTTCACCGATGGCGCGCTGTACCAGGT
CTATGCAGCCGTGGGCCGCGTAACCGTGGTGGCGCTCCAGCCGGGCGAGGAACTGGTGACGGTGGCGGCC
GGCGATACCGTGCGCTGGATCGTGGGGGATACCTCCAGCGGCTCCGGCGCGGACTTGCGGGTGAGCGTGA
TGGTCAAGCCGATCCGCTCAGGGCTCAAGACCAATCTGGTCATCACCACCAGCCGGCGCACCTATTTGTT
GGAACTGACCTCGACCGAGAAGACGTGGATGGCGTCGGTGTCCTGGGAGTACCCGAAGGACAGGATGCTG
GCCCTGCAGCGCCAGGCGCAGGCAGCCAGTGCCGCGGCGCCGGTCGATGCCGGGCTGTCACTGGAGAAGA
TCCGCTTTCGCTACGCCATCAGCGGCAGCAATCCGCCGTGGAAGCCCGAGCGCGTCTTTGATGATGGGCA
GAAAGTCTATGTGCAGTTTCCGTCGGGTATTGCGCAGGGCGAGTTGCCGCCGCTGTTTGTTATCGGCGCT
CAGGGCGACGGCCAACTCGTCAACTACCGTTTCCGATCGCCGTACCTGATCGTAGATCGGCTGTTCGGTG
CAGCCGAATTGCGCCTCGGCGGAGCCAAGGGCGACGTGGTGCGGATCGAGCGCACGGATGGTGCGAAGGG
GAAATGA
 Primer design