SecReT4
Protein ID: 190573302
T4SS name [ID]Trb [285]
Gene symboltrbF
Locus tagSmlt1285
StrainStenotrophomonas maltophilia K279a
Repliconchromosome [GenBank: NC_010943] [Browse all T4SS(s) in this replicon]
Location [Strand]1326979..1327683 [-]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDB2FTD7
KEGG IDsml:Smlt1285
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.5e-58, Aligned region: 23..225
Protein Sequence: 234 a.a.     [Download]
>gi|190573302|ref|YP_001971147.1| conjugal transfer protein TrbF [Stenotrophomonas maltophilia K279a]
MRFKRPQVRYADTPQPATPYQSAAQMWDERIGSARVQARNWRFMAFGCLTLAVLMAGGLVWRSAQSIVTP
YVIEVDNAGQVRAVGEAATPYQPSDAQVAYHLGRFIGLVRGLSIDPIVVRQNWLDAYDYTTDKGAVVLNE
YARGADPFSRIGKESVTVQVSSVTRASEASFNVRWTETRFVNGALDRTERWNAVVSTVLQTPRTEQRVRK
NPLGIYVNGLAWSRELEGNEGAKP
 
Nucleotide Sequence: 705 bp     [Download]
>gi|190572091|ref|NC_010943.1|:c1327683-1326979 Stenotrophomonas maltophilia K279a chromosome, complete genome
ATGCGATTCAAAAGACCGCAGGTGCGCTACGCCGATACGCCGCAGCCTGCCACCCCGTACCAATCCGCCG
CCCAGATGTGGGACGAGCGCATCGGCTCGGCCCGCGTGCAGGCCAGGAACTGGCGCTTCATGGCCTTCGG
CTGCCTCACCTTGGCCGTGCTGATGGCCGGGGGCCTGGTCTGGCGCTCGGCGCAGTCCATCGTGACGCCG
TACGTCATCGAGGTGGACAACGCGGGCCAGGTGCGCGCCGTGGGCGAGGCCGCCACGCCGTACCAGCCCA
GCGATGCCCAGGTGGCCTACCACCTGGGCCGCTTCATCGGGCTGGTGCGGGGCCTGTCCATCGACCCCAT
CGTGGTGCGGCAGAACTGGCTCGATGCCTATGACTACACCACCGACAAGGGCGCGGTGGTGCTCAACGAG
TACGCGCGAGGGGCCGATCCGTTTTCGCGCATCGGCAAGGAGTCGGTGACGGTACAGGTATCCAGCGTGA
CGCGCGCCAGCGAGGCGTCTTTCAACGTGCGCTGGACGGAGACGCGCTTCGTCAACGGCGCTCTGGACCG
CACCGAGCGCTGGAACGCGGTGGTTTCGACGGTGCTGCAAACCCCGCGCACCGAGCAGCGCGTGCGCAAG
AACCCTCTGGGCATCTACGTCAACGGGCTGGCGTGGAGCCGCGAACTGGAAGGGAACGAAGGAGCAAAAC
CATGA
 Primer design