SecReT4
Protein ID: 190573303
T4SS name [ID]Trb [285]
Gene symboltrbL
Locus tagSmlt1286
StrainStenotrophomonas maltophilia K279a
Repliconchromosome [GenBank: NC_010943] [Browse all T4SS(s) in this replicon]
Location [Strand]1327702..1329000 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDB2FTD8
KEGG IDsml:Smlt1286
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 9.5e-48, Aligned region: 37..265
Protein Sequence: 432 a.a.     [Download]
>gi|190573303|ref|YP_001971148.1| conjugal transfer protein TrbL [Stenotrophomonas maltophilia K279a]
MNDMTVIDHFLDVFSRYIDSGFGLLQGEVAFLTATLIVIDMTLAGLFWAMGHASGQGEDVIAKLLRKVLY
VGAFAYIIGNFNMLAGVVFRSFAGLGLTASGSTLSMGNFLQPGRLAKVGVDAAAPIFKQIGDLAGFPEVF
VHIDLIVVLFFAWLVVVLSFFVLAVQLFVTLIEFKLTALAGFVLVPFALWNKTAFLAEKVLGNVVSSGIK
VLVLAVIVGIGTGLFAEFRIPAGAEPSIDQALVIMLASLSMLALGIFGPGIATGLVSGGPQLGAGAMAGA
TLGAAGAAIGVGATAAGVGSAVAAGARMAPGAARMAASGARAATSAFEAGSSAAGGGLKGAAAGVGNVAK
TGARSMKERMAAAFRPDEAGSGAAPGASDAAASTPTTEQPAWAKRLHRRQQLTHAATTAAHTLRGGDGGS
SSQGPSLRDSDS
 
Nucleotide Sequence: 1299 bp     [Download]
>gi|190572091|ref|NC_010943.1|:c1329000-1327702 Stenotrophomonas maltophilia K279a chromosome, complete genome
ATGAATGACATGACGGTCATCGACCATTTTCTCGATGTCTTCTCGCGCTACATCGACTCGGGTTTCGGGC
TGCTGCAGGGCGAGGTGGCGTTCCTCACAGCCACGCTGATCGTCATCGACATGACGCTCGCCGGGCTGTT
CTGGGCGATGGGCCATGCCAGCGGCCAGGGCGAGGACGTGATCGCCAAGCTGCTGCGCAAGGTGCTCTAT
GTGGGCGCCTTCGCCTACATCATCGGCAACTTCAACATGCTCGCGGGCGTGGTGTTCCGCTCCTTCGCCG
GGTTGGGCCTGACGGCCAGCGGTTCGACGTTGAGCATGGGCAATTTCTTGCAGCCGGGTAGGTTGGCGAA
AGTGGGCGTTGATGCGGCAGCCCCCATCTTCAAGCAGATCGGCGACTTGGCGGGCTTCCCCGAAGTGTTC
GTCCACATCGACCTGATCGTGGTGCTGTTCTTCGCCTGGCTGGTAGTCGTTCTCAGCTTCTTCGTGCTGG
CGGTGCAGCTCTTCGTGACGCTGATCGAGTTCAAGCTGACCGCGCTGGCGGGCTTCGTGCTGGTGCCGTT
CGCGCTGTGGAACAAGACCGCGTTCCTGGCCGAGAAGGTGCTGGGCAACGTAGTGTCCTCGGGCATCAAG
GTGCTGGTGCTGGCCGTCATCGTCGGGATCGGAACGGGGCTGTTCGCCGAGTTCAGGATTCCCGCAGGGG
CCGAGCCTTCCATCGACCAGGCGCTGGTCATCATGCTGGCTTCGCTGTCCATGCTGGCCCTGGGCATCTT
CGGGCCGGGCATTGCGACCGGATTGGTATCTGGTGGGCCGCAGCTTGGCGCCGGTGCAATGGCAGGGGCC
ACGCTGGGGGCCGCAGGCGCCGCCATTGGCGTCGGCGCAACTGCGGCCGGTGTCGGCAGCGCGGTAGCTG
CCGGGGCACGCATGGCTCCAGGCGCTGCCCGCATGGCGGCCAGCGGCGCGCGTGCTGCGACCTCGGCGTT
TGAAGCGGGTTCGTCCGCTGCTGGCGGCGGCCTCAAGGGCGCTGCCGCCGGTGTGGGCAACGTCGCCAAG
ACCGGCGCGCGCTCGATGAAGGAGCGCATGGCCGCCGCCTTTCGGCCCGATGAGGCTGGATCTGGTGCCG
CACCGGGCGCAAGCGATGCCGCAGCCTCTACCCCAACAACCGAACAACCCGCCTGGGCCAAGCGCCTGCA
CCGCAGGCAGCAGCTCACCCATGCCGCGACCACGGCCGCCCACACGCTGCGCGGCGGCGACGGGGGCAGC
TCCAGCCAGGGGCCGAGCCTCCGTGATTCCGATTCCTGA
 Primer design