SecReT4
Protein ID: 190573304
T4SS name [ID]Trb [285]
Gene symboltrbJ
Locus tagSmlt1287
StrainStenotrophomonas maltophilia K279a
Repliconchromosome [GenBank: NC_010943] [Browse all T4SS(s) in this replicon]
Location [Strand]1329012..1329749 [-]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDB2FTD9
KEGG IDsml:Smlt1287
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 245 a.a.     [Download]
>gi|190573304|ref|YP_001971149.1| conjugal transfer protein TrbJ [Stenotrophomonas maltophilia K279a]
MKPRMLSAALAAVLSGSLMFAQPAAALIVFDPSNFVQNMLTAIQTLQQLYNQIKQLQNEAKMLENQARNL
ASLPSSVVGQLRANLALTQRLIDQAKGLAYDVARMDRDFARLYPEQYAATVSGDQMYRDTQERWKNTLTS
LQTAMQMQAQASQNLKDDEGVLADLVGKSQSAVGALQAMQATNQLLALQAKQSIQTQRLQLTQDRAASLE
QARQAAAVERGREVRRRFLGTGTPYTPQSVHFYGN
 
Nucleotide Sequence: 738 bp     [Download]
>gi|190572091|ref|NC_010943.1|:c1329749-1329012 Stenotrophomonas maltophilia K279a chromosome, complete genome
ATGAAACCCCGCATGCTTTCCGCAGCCCTGGCTGCCGTGCTGTCCGGTTCACTCATGTTCGCCCAGCCGG
CCGCGGCCCTCATCGTGTTCGATCCCTCGAACTTCGTGCAGAACATGCTGACGGCCATCCAGACGCTGCA
GCAGCTCTACAACCAGATCAAGCAGCTGCAGAACGAGGCCAAGATGCTGGAGAACCAGGCCCGCAATCTG
GCGAGCCTGCCATCCAGTGTGGTCGGTCAGTTGCGCGCCAACCTCGCGCTGACGCAGCGGCTGATCGACC
AGGCCAAGGGCCTGGCCTATGACGTGGCCAGGATGGATCGAGACTTTGCCCGGCTGTACCCAGAGCAGTA
CGCCGCCACCGTGAGCGGCGACCAGATGTACCGGGACACGCAGGAGCGCTGGAAGAACACGCTCACCAGC
TTGCAGACTGCCATGCAGATGCAGGCCCAGGCCTCGCAGAACCTCAAGGACGACGAGGGTGTGTTGGCCG
ATCTGGTGGGCAAGAGCCAGTCGGCCGTGGGCGCGCTGCAGGCGATGCAGGCCACCAACCAGCTTCTGGC
TTTGCAGGCCAAGCAGTCGATCCAAACGCAGCGCTTGCAACTCACGCAGGATCGCGCCGCGTCGCTGGAG
CAGGCACGGCAGGCCGCCGCGGTCGAGCGCGGCCGTGAAGTACGGCGGCGTTTCCTGGGCACCGGTACGC
CGTACACGCCGCAGTCCGTCCATTTCTACGGCAACTGA
 Primer design