SecReT4
Protein ID: 190573305
T4SS name [ID]Trb [285]
Gene symboltrbE
Locus tagSmlt1288
StrainStenotrophomonas maltophilia K279a
Repliconchromosome [GenBank: NC_010943] [Browse all T4SS(s) in this replicon]
Location [Strand]1329746..1332232 [-]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDB2FTE0
KEGG IDsml:Smlt1288
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.3e-38, Aligned region: 456..725
CagE_TrbE_VirB [PF03135], Evalue: 3.6e-15, Aligned region: 254..402
DUF853 [PF05872], Evalue: 4.3e-07, Aligned region: 609..698
TraG-D_C [PF12696], Evalue: 7.2e-05, Aligned region: 649..715
Protein Sequence: 828 a.a.     [Download]
>gi|190573305|ref|YP_001971150.1| conjugal transfer ATPase TrbE [Stenotrophomonas maltophilia K279a]
MLNLAEYRQRPARLADWLPWAGLVATGVVLNKDGSFQRTARFRGPDLDSATQGELIATSARLNNALRRLG
SGWALFIEAERRAAADYPHSDFPEPLSWLVDEERRAAFEGEAKDETLRGSVSRPNGNHFESGYHLTLVYL
PAEESRARAAGMLYENRPTEGVDWRERLTAFIAETDRFFDLLDGVMPEIAWLDDSQTLTYLHSTISTRRY
RVGLPEVPFHLDALLADAPLIGGLAPMLGDQHLRVATVRGFPTSTWPGILDDLNRLGFAYRWSTRFLCLD
KADAEKELSRLRRQWFAKRKNVIALLRETIFQQESPLVDTDASNKSADADAALQELGSDQVAFGYLTATI
TVMDSDAAVADEKLRMVERVIQGRGFVTIPETLNAVDAWLSSIPGHAYANVRQPIVSTLNLAHLMPVSAV
WAGPERNDHLDGPPLIVTRTEGATPFRLVTHIGDVGHTLVAGPTGMGKSVLLATLAMQFRRYRGSRIFAF
DMGRSMRATILGLGGEHYDLGMDGEIAFQPLARIEREGYRTWASEWIEGRFRHEGVAVGPDEKVAIWSAL
GSLAGAPPEQRTMTGLSVLLQSNALRQALAPYVLGGAHGKLLDADSDRLGAGSVQCFEMEELMHSKAAVM
AVLHYLFARFDERFDGAPTLLILDEAWQFLDDPVFAARIRQWLKTLRKKNVSVIFATQSLADIKDSSIAP
AIIESCASRIFLPNPQATEPQIRTIYEGFGLNSRQIEIVATAVPKRDYYYQSRLGNRLFDLDLGAATLAF
AGASTPKDQRDIDAVLAAAHSDSSAASSFAATWLRHRGLHWAAGLLSSFPSHPQEISP
 
Nucleotide Sequence: 2487 bp     [Download]
>gi|190572091|ref|NC_010943.1|:c1332232-1329746 Stenotrophomonas maltophilia K279a chromosome, complete genome
ATGCTGAACCTTGCCGAATACCGCCAGCGGCCCGCACGGCTGGCCGACTGGCTGCCCTGGGCGGGACTGG
TCGCCACAGGCGTTGTGCTGAACAAGGACGGTTCCTTTCAACGCACGGCCCGGTTTCGTGGCCCCGATCT
CGATAGCGCCACGCAGGGCGAACTGATCGCCACGTCAGCGCGCTTGAACAACGCACTGCGGCGGCTGGGT
TCGGGCTGGGCCTTGTTCATCGAGGCCGAGCGCCGGGCCGCCGCCGACTATCCACACTCGGATTTCCCAG
AACCCCTGTCGTGGCTGGTGGACGAGGAACGCCGCGCCGCCTTCGAGGGTGAGGCCAAAGACGAAACGCT
CCGGGGGAGCGTTTCGCGGCCGAACGGCAACCACTTCGAGAGCGGCTACCACCTGACACTGGTGTACCTG
CCTGCGGAAGAATCGCGCGCCCGTGCCGCCGGGATGCTGTACGAGAACCGTCCGACCGAAGGCGTGGACT
GGCGTGAGCGCCTGACCGCCTTCATAGCGGAAACGGATCGCTTCTTTGACTTGCTCGACGGCGTGATGCC
GGAAATCGCGTGGCTCGACGACAGCCAGACGCTGACCTATCTGCATTCGACCATCTCCACGCGGCGCTAC
CGCGTGGGCCTGCCCGAGGTGCCGTTCCACCTCGACGCGCTGCTGGCCGATGCGCCGCTGATCGGTGGCC
TGGCCCCCATGCTGGGCGACCAGCACCTGCGCGTGGCAACGGTGCGGGGCTTCCCGACCTCGACCTGGCC
GGGGATTCTGGACGACCTCAATCGCCTCGGCTTTGCCTATCGCTGGAGTACGCGCTTTCTCTGTCTCGAC
AAAGCCGATGCGGAAAAGGAGCTTTCCCGCCTGCGCCGCCAGTGGTTCGCCAAGCGCAAGAATGTGATCG
CCTTGCTGCGCGAAACCATCTTCCAGCAGGAATCCCCGCTGGTCGATACCGACGCCAGCAATAAATCGGC
CGACGCCGACGCCGCCTTGCAGGAGCTGGGCAGCGACCAGGTGGCCTTCGGCTACCTGACGGCGACCATC
ACTGTCATGGACTCGGATGCGGCCGTGGCCGATGAGAAGCTGCGGATGGTGGAGCGAGTCATCCAGGGCC
GGGGCTTCGTGACCATCCCCGAGACCTTGAACGCGGTCGATGCGTGGCTGTCCTCGATTCCGGGCCATGC
CTACGCCAACGTGCGCCAACCCATCGTCTCGACGCTGAACCTGGCGCACCTGATGCCGGTGTCGGCAGTA
TGGGCTGGCCCCGAGCGCAATGACCACCTCGACGGCCCACCGCTGATCGTGACCCGCACCGAGGGCGCGA
CGCCGTTCCGGCTGGTCACGCACATCGGCGACGTGGGCCACACGCTGGTGGCCGGGCCGACCGGCATGGG
CAAGTCGGTGCTGCTTGCCACGCTGGCAATGCAGTTCCGGCGCTACCGTGGCTCGCGCATCTTCGCCTTC
GACATGGGGCGCTCGATGCGCGCCACCATTCTGGGCCTGGGCGGCGAGCATTACGACCTGGGCATGGATG
GCGAGATCGCTTTCCAACCCTTGGCCCGCATCGAACGCGAGGGCTATCGCACCTGGGCCTCCGAATGGAT
CGAGGGCCGGTTTCGGCACGAGGGCGTGGCGGTCGGCCCAGACGAAAAGGTAGCTATCTGGTCGGCGCTC
GGCAGTCTCGCCGGCGCTCCGCCGGAGCAGCGCACGATGACGGGCCTGTCGGTGCTGCTGCAATCGAACG
CGCTGCGCCAGGCGCTCGCGCCCTATGTCCTCGGCGGCGCGCACGGCAAGCTGCTGGATGCGGATTCGGA
TCGCCTGGGCGCCGGCTCCGTGCAGTGCTTCGAGATGGAGGAGCTGATGCACAGCAAGGCCGCCGTCATG
GCCGTGCTGCATTACCTCTTTGCGCGCTTCGATGAACGCTTCGACGGTGCGCCCACGCTGCTGATCCTCG
ACGAGGCCTGGCAGTTCCTCGACGATCCGGTGTTTGCGGCGCGCATCCGCCAGTGGCTGAAGACGCTGCG
CAAGAAGAACGTCTCGGTGATCTTCGCCACGCAGTCGCTGGCGGACATCAAGGATTCGAGCATCGCGCCG
GCCATCATCGAGAGCTGCGCGAGCCGCATCTTCCTGCCGAACCCGCAGGCGACCGAGCCGCAGATCAGGA
CGATCTACGAGGGCTTCGGGCTCAACAGCCGCCAGATCGAGATCGTCGCCACGGCAGTTCCGAAGCGCGA
CTACTACTACCAGTCCCGTCTGGGCAACCGCCTGTTCGACCTCGACCTGGGCGCCGCGACCTTGGCCTTT
GCGGGCGCCTCCACGCCGAAAGACCAGCGCGACATCGACGCGGTGCTGGCTGCTGCGCATTCCGACTCCT
CTGCTGCTTCTTCATTCGCAGCCACCTGGCTGCGCCATCGCGGCCTGCATTGGGCCGCCGGTCTGCTGTC
CTCGTTTCCTTCCCACCCACAGGAGATCTCGCCATGA
 Primer design