SecReT4
Protein ID: 190573306
T4SS name [ID]Trb [285]
Gene symboltrbD
Locus tagSmlt1289
StrainStenotrophomonas maltophilia K279a
Repliconchromosome [GenBank: NC_010943] [Browse all T4SS(s) in this replicon]
Location [Strand]1332243..1332515 [-]
Productconjugal transfer protein
Component typeTrbD
UniProt IDB2FTE1
KEGG IDsml:Smlt1289
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 4.8e-11, Aligned region: 13..84
Protein Sequence: 90 a.a.     [Download]
>gi|190573306|ref|YP_001971151.1| conjugal transfer protein [Stenotrophomonas maltophilia K279a]
MNGLHDGLPGFEVPLHRSLTEPILMGGAPRTVAITNGTLATAVGLGLQMWIPGVVLWVVGHALAVWGARV
DPQFMQVFARHIKHRPLLDV
 
Nucleotide Sequence: 273 bp     [Download]
>gi|190572091|ref|NC_010943.1|:c1332515-1332243 Stenotrophomonas maltophilia K279a chromosome, complete genome
ATGAACGGCCTGCACGATGGATTACCGGGATTCGAGGTGCCGCTGCATCGGTCGTTGACCGAGCCGATCC
TGATGGGCGGCGCTCCGCGCACCGTAGCCATCACCAATGGCACCTTGGCCACCGCCGTGGGCCTGGGCCT
GCAGATGTGGATTCCAGGCGTGGTGCTCTGGGTCGTCGGCCATGCGCTGGCGGTCTGGGGGGCGCGTGTC
GATCCGCAGTTTATGCAGGTCTTCGCCCGCCACATCAAGCACCGGCCGCTGCTGGACGTGTGA
 Primer design