SecReT4
Protein ID: 190573307
T4SS name [ID]Trb [285]
Gene symboltrbC
Locus tagSmlt1290
StrainStenotrophomonas maltophilia K279a
Repliconchromosome [GenBank: NC_010943] [Browse all T4SS(s) in this replicon]
Location [Strand]1332512..1332895 [-]
Productconjugal transfer protein
Component typeTrbC
UniProt IDB2FTE2
KEGG IDsml:Smlt1290
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.3e-24, Aligned region: 27..117
Protein Sequence: 127 a.a.     [Download]
>gi|190573307|ref|YP_001971152.1| conjugal transfer protein [Stenotrophomonas maltophilia K279a]
MTQMIVPAFRISANPLRRPAWLDGLARPALQGLMLAALMLLLAGTAQAAGSSMPWEGPLQSILESIQGPV
ARIIAVIIIIATGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFSGGAVV
 
Nucleotide Sequence: 384 bp     [Download]
>gi|190572091|ref|NC_010943.1|:c1332895-1332512 Stenotrophomonas maltophilia K279a chromosome, complete genome
ATGACGCAGATGATCGTTCCTGCTTTCCGTATTTCCGCAAATCCTCTTCGCCGGCCCGCGTGGCTGGACG
GTCTGGCTCGTCCGGCCCTGCAGGGTCTGATGCTCGCGGCGCTGATGCTGCTGCTCGCGGGCACCGCGCA
GGCCGCGGGTTCCTCGATGCCGTGGGAAGGCCCGCTGCAGTCCATTCTCGAATCCATCCAGGGGCCGGTG
GCGCGGATCATCGCGGTCATCATCATCATCGCCACGGGTCTGGCGCTGGCTTTCGGCGATACCTCGGGCG
GGTTCCGCAAGCTGATCCAGATCGTCTTCGGGTTGTCGATCGCGTTTGCCGCGTCCTCGTTCTTCCTGTC
GTTCTTCAGCTTTTCCGGTGGGGCTGTCGTATGA
 Primer design