SecReT4
Protein ID: 190573308
T4SS name [ID]Trb [285]
Gene symboltrbB
Locus tagSmlt1291
StrainStenotrophomonas maltophilia K279a
Repliconchromosome [GenBank: NC_010943] [Browse all T4SS(s) in this replicon]
Location [Strand]1332892..1333932 [-]
Productconjugal transfer protein
Component typeTrbB
UniProt IDB2FTE3
KEGG IDsml:Smlt1291
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.2e-80, Aligned region: 28..294
TrwB_AAD_bind [PF10412], Evalue: 7e-07, Aligned region: 143..187
FtsK_SpoIIIE [PF01580], Evalue: 2.4e-05, Aligned region: 146..210
Protein Sequence: 346 a.a.     [Download]
>gi|190573308|ref|YP_001971153.1| conjugal transfer protein [Stenotrophomonas maltophilia K279a]
MNSAPPASSTATSLDRRIQMLRTAMGPLIAAALEDPDVVEIMLNPDRTLWIDRLSSGRAPMGVELSEADG
ERIIRLVAAHVGAEVHRGQPLLTAELPETGERFEGILPPAAPGPAFALRKRAFGVIPLSRYIEDGMMTAA
QAGLLVRAVRERQNILIAGGTSTGKTTLANALLAEIAATGDRVLVLEDTVELQCAARDHVPLRTRAGVVS
MTELVRSSMRLRPDRVVVGEVRGAEALDLIKVWGTGHPGGIATIHAGSALGALLRLEQLILEVAVNPPRA
LIAEAVNVVIHIAGRGRKRRIESIARVIGFDGVGYQLADALEAPFPELLPQSELSSLSPDHSGELP
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|190572091|ref|NC_010943.1|:c1333932-1332892 Stenotrophomonas maltophilia K279a chromosome, complete genome
ATGAATTCCGCACCGCCAGCTTCTTCCACGGCCACCTCGCTCGACCGCCGCATCCAGATGCTGCGCACCG
CCATGGGCCCGCTGATCGCCGCCGCACTCGAAGACCCGGATGTGGTGGAAATCATGCTCAACCCGGATCG
CACCTTGTGGATCGACCGGCTTTCATCGGGCCGCGCACCGATGGGCGTGGAGCTGTCCGAAGCAGACGGC
GAACGCATCATCCGGCTGGTGGCTGCCCACGTCGGCGCGGAAGTGCATCGCGGCCAGCCGTTGTTGACGG
CCGAGCTGCCCGAGACGGGCGAACGCTTCGAGGGCATCTTGCCGCCGGCTGCGCCGGGGCCGGCCTTCGC
CTTGCGCAAGCGCGCCTTTGGCGTGATCCCGCTGTCGCGCTACATCGAGGACGGGATGATGACCGCCGCG
CAGGCCGGCCTGCTGGTGCGCGCCGTGCGCGAGCGCCAGAACATCCTGATCGCCGGTGGGACGAGTACCG
GCAAGACCACCCTGGCCAATGCCTTGCTGGCCGAGATCGCCGCCACCGGCGACCGCGTGCTGGTGCTCGA
AGACACGGTGGAGCTGCAATGCGCGGCCCGCGACCACGTGCCGCTGCGCACGCGCGCGGGCGTGGTGTCC
ATGACCGAGCTGGTGCGTTCGTCCATGCGCCTACGGCCGGATCGCGTCGTCGTCGGCGAGGTACGCGGCG
CCGAGGCGCTGGATCTCATCAAGGTCTGGGGCACCGGCCATCCGGGCGGCATCGCCACGATCCACGCCGG
CTCCGCGCTGGGCGCGCTGCTGCGCCTGGAGCAACTGATTCTCGAAGTGGCGGTGAACCCGCCCCGTGCG
CTGATCGCGGAAGCGGTCAACGTGGTCATCCACATCGCCGGGCGCGGGCGCAAGCGCCGCATCGAGAGCA
TCGCCCGCGTCATCGGCTTCGATGGCGTGGGCTACCAACTGGCGGATGCGCTGGAGGCTCCATTCCCGGA
GTTGTTGCCGCAGTCCGAACTTTCCTCCCTGTCCCCTGACCACTCTGGAGAACTGCCATGA
 Primer design