SecReT4
Protein ID: 190573325
T4SS name [ID]Trb [285]
Gene symbol-
Locus tagSmlt1310
StrainStenotrophomonas maltophilia K279a
Repliconchromosome [GenBank: NC_010943] [Browse all T4SS(s) in this replicon]
Location [Strand]1348056..1348631 [-]
Producttransmembrane anchor conjugal transfer protein
Component typeTraF
UniProt IDB2FTG2
KEGG IDsml:Smlt1310
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 3.1e-53, Aligned region: 50..186
Protein Sequence: 191 a.a.     [Download]
>gi|190573325|ref|YP_001971170.1| transmembrane anchor conjugal transfer protein [Stenotrophomonas maltophilia K279a]
MTLPSIVADATEIPPHPRSRLRARIVLASLSACGLAALAWAAFVQPLPRLVYNPSDSVPIGWYRIGSSDA
LHVGAIVLTTLPPDAAALAAQRRYLPAHVPLLKRVGAVAPQHVCVFDALVWIDGVPVAAVLPADRLGRPL
PSWPHCRRLEAGELFLLSSTNPASFDSRYFGLVSASAVIGVAHSLWLESRP
 
Nucleotide Sequence: 576 bp     [Download]
>gi|190572091|ref|NC_010943.1|:c1348631-1348056 Stenotrophomonas maltophilia K279a chromosome, complete genome
ATGACACTCCCATCTATCGTTGCCGATGCAACTGAAATCCCGCCACATCCTCGCTCACGCCTGCGCGCTC
GCATCGTTTTGGCGAGCCTGTCCGCCTGCGGCCTCGCGGCGCTGGCCTGGGCGGCTTTCGTACAGCCGCT
GCCGCGCCTGGTCTACAACCCGTCCGACAGTGTTCCGATCGGCTGGTATCGCATCGGGTCGTCCGATGCG
CTGCACGTCGGCGCCATCGTCCTCACCACGCTGCCGCCTGACGCTGCTGCGCTGGCCGCGCAGCGCCGCT
ACCTCCCGGCGCACGTGCCGCTGCTCAAGCGCGTGGGCGCCGTGGCGCCGCAGCATGTATGCGTGTTCGA
TGCGCTGGTGTGGATCGACGGCGTGCCGGTGGCCGCCGTGCTGCCCGCCGACCGGCTGGGCAGGCCGCTG
CCATCCTGGCCGCATTGCCGCCGCCTCGAAGCTGGCGAGCTGTTCCTGTTGAGCAGCACCAACCCGGCGT
CGTTCGACAGCCGCTACTTCGGGCTGGTCAGCGCATCCGCCGTGATCGGCGTGGCGCATTCGCTCTGGCT
GGAGTCACGGCCATGA
 Primer design