SecReT4
Protein ID: 190574902
T4SS name [ID]VirB [404]
Gene symbol-
Locus tagSmlt3003
StrainStenotrophomonas maltophilia K279a
Repliconchromosome [GenBank: NC_010943] [Browse all T4SS(s) in this replicon]
Location [Strand]3047694..3048737 [-]
Producttype IV secretion system conjugal transfer protein
Component typeVirB11
UniProt IDB2FJH4
KEGG IDsml:Smlt3003
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 7.2e-62, Aligned region: 27..325
Protein Sequence: 347 a.a.     [Download]
>gi|190574902|ref|YP_001972747.1| type IV secretion system conjugal transfer protein [Stenotrophomonas maltophilia K279a]
MDAEVSPLALVSSDFLRYQYEVLGIAEYMTSPEVTEICINRPGELYLETRAGWQRVDVPGLTFERARQFC
TAVVNESNTGQRITDADPVVSLTFPTGQRAQFVIPPACDAGKVSITIRLPSKHTKSLTQYHEDGFFNQIL
EQDGSLSEQDRELLELRQQREYAEFFRRAVMYRKNIVVSGATGSGKTTFMKALVNHIPDNERLVTIEDAR
ELFLTQPNVVHLLYSKGGQSTSNVSAKSCMEACLRMKPERIILAELRGDEAFYFIRNCASGHPGSITSCH
AGSPEQTWDQLALMVKASAEGSGLEFNVIKRLLMMTIDIVVHIKAHAGSRYITGIDFNPGRAQGQEG
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|190572091|ref|NC_010943.1|:c3048737-3047694 Stenotrophomonas maltophilia K279a chromosome, complete genome
ATGGACGCCGAAGTGTCACCCCTCGCCCTCGTTTCTAGCGATTTCCTGCGCTATCAGTACGAAGTGCTGG
GCATCGCCGAGTACATGACATCCCCGGAAGTGACGGAAATCTGCATCAACCGTCCCGGTGAGCTGTACCT
GGAAACCCGGGCCGGGTGGCAGCGGGTGGACGTGCCGGGCCTGACCTTCGAGCGGGCCCGGCAGTTCTGC
ACCGCCGTAGTGAACGAAAGCAACACCGGCCAGCGCATCACCGATGCCGATCCGGTGGTGTCGCTCACGT
TCCCCACCGGCCAGCGTGCGCAGTTCGTGATTCCACCTGCCTGTGATGCCGGCAAGGTTTCGATCACGAT
CCGCCTGCCGTCCAAGCACACCAAGTCGCTCACCCAGTACCACGAGGATGGTTTCTTCAACCAGATCCTG
GAACAGGATGGCAGTCTGAGCGAGCAGGACCGCGAGCTGCTGGAACTGCGCCAGCAGCGCGAGTACGCAG
AGTTCTTCCGTCGTGCGGTGATGTACCGCAAGAACATCGTGGTCTCCGGTGCGACCGGTAGCGGCAAGAC
CACCTTCATGAAAGCGCTGGTCAATCATATCCCGGACAACGAGCGCCTGGTCACGATCGAGGACGCACGC
GAGCTGTTTCTGACCCAACCCAATGTGGTGCACCTGCTGTACTCCAAGGGCGGGCAGAGCACCAGCAATG
TCAGCGCAAAGAGTTGCATGGAAGCCTGCCTGCGCATGAAGCCAGAACGCATCATCCTGGCCGAGCTGCG
CGGTGACGAGGCGTTCTACTTCATCCGCAACTGCGCATCGGGCCACCCGGGCTCGATCACCAGTTGCCAT
GCCGGCAGCCCGGAGCAGACCTGGGATCAGCTGGCGCTGATGGTGAAGGCCTCGGCCGAGGGTTCGGGCC
TGGAGTTCAACGTGATCAAGCGACTGTTGATGATGACCATCGACATCGTCGTGCATATCAAGGCGCATGC
CGGCTCGCGCTACATCACCGGCATCGACTTCAATCCTGGGCGTGCCCAGGGGCAGGAGGGCTGA
 Primer design