SecReT4
Protein ID: 190574905
T4SS name [ID]VirB [404]
Gene symbol-
Locus tagSmlt3006
StrainStenotrophomonas maltophilia K279a
Repliconchromosome [GenBank: NC_010943] [Browse all T4SS(s) in this replicon]
Location [Strand]3050778..3051824 [-]
Productconjugative transfer protein
Component typeVirB8
UniProt IDB2FJH7
KEGG IDsml:Smlt3006
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 9.7e-56, Aligned region: 20..240
Protein Sequence: 348 a.a.     [Download]
>gi|190574905|ref|YP_001972750.1| conjugative transfer protein [Stenotrophomonas maltophilia K279a]
MFRKKDPGNSPKVEQSVAKAVSYEITVADMARRSERRAWWVATGSLLMSLALAGGYYYMLPLKEKVPFLV
MADAYTGTATVARLRGTFQGETITTNEAVNRSNVAQYVLARESYDSAVMGLRDWELVFVMSSDAVAASMK
QRYASNNPQNPFVMYGRGKAIRVKILSITPLGVQANGSFRGASVRIQRSLLDKRSGVSTYLDNQLVTMRF
QYNQNLALSEQDRVLNPLAFQVTEYRVDNDYARGVPVPDDGAMQQQAQDAAQQAQLAAQQAQGMYVPNNP
AAATMIDPATGQPVAVPANGQMQPMQGAPMQGQPVQGQPMPGQGAPGQPAMMPAPNHSTGNADGASNR
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|190572091|ref|NC_010943.1|:c3051824-3050778 Stenotrophomonas maltophilia K279a chromosome, complete genome
ATGTTCCGCAAGAAGGATCCCGGCAATAGTCCCAAGGTCGAGCAGTCGGTCGCCAAGGCGGTCAGCTACG
AGATCACCGTGGCCGACATGGCGCGTCGCAGTGAGCGCCGCGCCTGGTGGGTCGCCACCGGCTCATTGCT
GATGTCGCTGGCACTGGCGGGCGGCTACTACTACATGCTGCCGCTGAAGGAGAAGGTGCCGTTCCTGGTG
ATGGCCGATGCCTACACGGGTACCGCTACGGTGGCGCGCCTGAGGGGCACGTTCCAGGGCGAGACGATCA
CCACCAACGAAGCGGTCAACCGCAGCAATGTCGCCCAGTACGTGCTGGCGCGCGAGTCGTACGACTCCGC
GGTGATGGGGTTGCGCGACTGGGAGCTGGTGTTCGTCATGTCCAGTGATGCCGTGGCCGCAAGCATGAAG
CAGCGCTATGCCAGCAACAATCCGCAGAATCCGTTCGTGATGTACGGCCGGGGCAAGGCGATCAGGGTCA
AGATCCTCAGCATCACCCCGCTGGGCGTGCAGGCGAACGGCAGCTTCCGTGGCGCGTCCGTGCGCATCCA
GCGCAGCCTGCTCGACAAGCGCAGCGGTGTGTCGACCTATCTGGACAACCAGCTGGTCACCATGCGCTTC
CAGTACAACCAGAATCTGGCGCTCTCCGAACAGGACCGCGTGCTCAACCCATTGGCGTTCCAGGTCACGG
AGTACCGTGTCGACAACGACTATGCGCGCGGGGTACCCGTGCCGGATGACGGTGCCATGCAGCAGCAGGC
CCAGGATGCCGCGCAACAGGCACAGCTCGCCGCGCAGCAGGCGCAGGGCATGTACGTTCCGAACAATCCG
GCCGCTGCCACCATGATCGATCCCGCCACCGGTCAGCCTGTCGCAGTGCCGGCCAATGGGCAGATGCAGC
CGATGCAGGGTGCGCCCATGCAGGGGCAGCCGGTCCAGGGGCAGCCGATGCCGGGGCAGGGCGCGCCGGG
ACAGCCGGCAATGATGCCGGCACCGAACCATTCCACCGGAAATGCTGATGGAGCAAGCAACCGATGA
 Primer design