SecReT4
Protein ID: 190574907
T4SS name [ID]VirB [404]
Gene symbol-
Locus tagSmlt3008
StrainStenotrophomonas maltophilia K279a
Repliconchromosome [GenBank: NC_010943] [Browse all T4SS(s) in this replicon]
Location [Strand]3052785..3054464 [-]
Producttransmembrane conjugative DNA transfer protein
Component typeVirD4
UniProt IDB2FJH9
KEGG IDsml:Smlt3008
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.3e-108, Aligned region: 125..550
TraG-D_C [PF12696], Evalue: 2.4e-27, Aligned region: 402..515
TrwB_AAD_bind [PF10412], Evalue: 2.3e-23, Aligned region: 188..520
Protein Sequence: 559 a.a.     [Download]
>gi|190574907|ref|YP_001972752.1| transmembrane conjugative DNA transfer protein [Stenotrophomonas maltophilia K279a]
MLPSKKYLLIAIVTLATLLLGFVFSGYLTLLFLGLDTKLFTWNTYYQYYHAIGQPQVAPFVGKIKWAGYV
GFGLPLLVLLVTGLVLLLKKDKRSLHGDARFATGADLSRHGMFKKTGQSIVVGSHGGKLVRLDGQQFVIL
AAPTRSGKGVGVVIPNLLEYGESLVVLDIKQENFDLTSGWRASQGQEIYLFNPFAEDRRTHRWNPLSYVS
DDPAFRVSDLMSIAAMLYPDGAEDQKFWVSQARNAFMAFTLYLFENWDDERSSGFPGGSGTPTLGSVYRL
SSGDGTDLKKYLKALSERSFLSGNARSAFANMLSQADETFASILGTFKEPLNPWINPVLDKATSSNDFLL
TDVRKKKMTIYIGIQPNKLAESRLIINLFFSQLINLNTKELPKSNPDLKYQCLLLMDEFTSIGKVEIIAS
AVSYMAGYNIRLLPIIQSMSQLDATYGREVSRTIITNHALQILYAPREQQDANDYSDMLGYTTIRKKNVT
HAREKTHSFTEERRALMLPQELKAMGPDKEVFLYEGIPHPVKCDKIRYYKDRYFTSRLLPKVDVPMLNV
 
Nucleotide Sequence: 1680 bp     [Download]
>gi|190572091|ref|NC_010943.1|:c3054464-3052785 Stenotrophomonas maltophilia K279a chromosome, complete genome
GTGTTGCCCAGTAAGAAGTATCTGCTCATCGCCATCGTCACGCTGGCGACCCTGCTGCTTGGTTTCGTGT
TTTCCGGCTACCTGACCCTGTTGTTCCTGGGGTTGGACACCAAGCTGTTCACCTGGAACACGTACTACCA
GTACTACCACGCCATCGGCCAACCGCAGGTTGCGCCGTTCGTGGGCAAGATCAAGTGGGCCGGCTACGTG
GGCTTCGGCTTGCCGCTGCTGGTCCTGCTGGTGACCGGTCTGGTGCTGCTGCTGAAGAAGGACAAGCGCT
CGCTGCATGGCGACGCGCGTTTCGCCACCGGCGCCGACCTGTCCAGGCATGGCATGTTCAAGAAGACCGG
CCAGAGCATCGTGGTCGGCAGCCATGGCGGCAAACTGGTGCGGCTGGATGGCCAGCAGTTCGTGATTCTT
GCGGCACCCACCCGTTCAGGCAAGGGCGTGGGCGTGGTCATCCCGAACCTGCTGGAATACGGCGAATCGC
TGGTGGTGCTGGACATCAAGCAGGAGAACTTCGACCTGACCAGCGGCTGGCGCGCCAGCCAGGGCCAGGA
GATCTACCTGTTCAATCCCTTCGCCGAGGATCGGCGCACGCACCGCTGGAACCCGCTCAGCTATGTCTCC
GATGATCCGGCATTCCGGGTGTCGGACCTGATGAGCATCGCCGCGATGCTGTATCCGGACGGCGCCGAGG
ACCAGAAGTTCTGGGTCAGCCAGGCGCGCAACGCGTTCATGGCCTTCACCCTGTATCTGTTCGAAAACTG
GGACGACGAGCGCAGCAGCGGCTTCCCGGGCGGCTCGGGCACGCCGACGCTGGGTTCTGTCTACCGGTTG
TCATCCGGCGATGGCACCGATCTGAAGAAGTACCTCAAGGCCTTGTCGGAGCGTTCATTCCTCAGTGGCA
ACGCGCGATCGGCGTTCGCCAACATGCTGTCCCAGGCCGACGAGACCTTCGCCTCGATCCTGGGCACCTT
CAAGGAACCGCTCAATCCCTGGATCAACCCGGTGCTGGACAAGGCCACCAGCAGCAACGACTTCCTGCTG
ACCGACGTGCGCAAGAAGAAGATGACCATCTACATCGGCATCCAGCCGAACAAGCTGGCCGAGAGCCGGC
TGATCATCAACCTGTTCTTCAGCCAGCTGATCAACCTCAACACCAAGGAACTGCCCAAGTCCAACCCGGA
CCTGAAGTACCAGTGCCTGCTGCTGATGGACGAATTCACCTCGATCGGCAAGGTCGAGATCATCGCCTCG
GCGGTGTCCTACATGGCCGGTTACAACATCCGCCTGCTGCCGATCATCCAGAGCATGTCCCAGCTCGATG
CCACCTACGGCCGGGAAGTCTCGCGCACGATCATCACCAACCACGCGCTGCAGATCCTGTACGCGCCGCG
CGAGCAGCAGGACGCCAACGACTATTCGGACATGCTGGGCTACACCACCATCCGCAAGAAGAACGTCACG
CACGCCCGCGAGAAGACCCACAGCTTCACCGAGGAGCGGCGGGCACTGATGCTGCCGCAGGAGCTGAAGG
CGATGGGGCCGGACAAGGAAGTGTTCCTGTACGAGGGCATACCGCATCCGGTGAAGTGCGACAAGATCCG
CTACTACAAGGATCGCTACTTCACCTCGCGGCTGCTGCCGAAAGTCGACGTTCCAATGCTTAACGTCTAA
 Primer design