SecReT4
Protein ID: 190606606
T4SS name [ID]VirB [428]
Gene symbolvirB8
Locus tagpMBO2_p26
StrainMoraxella bovis Epp63 plasmid pMBO-2 (NC_010900)
Repliconplasmid pMBO-2 [GenBank: NC_010900] [Browse all T4SS(s) in this replicon]
Location [Strand]19509..20267 [-]
ProductVirB8-like protein
Component typeVirB8
UniProt IDQ5KT89
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 8.4e-52, Aligned region: 30..248
Protein Sequence: 252 a.a.     [Download]
>gi|190606606|ref|YP_001966425.1| VirB8-like protein [Moraxella bovis Epp63]
MFKSKKAPANKVQKDKKISDNQAINDYLKEARGFEKSRIEFVEKSKTFWQYVALGAVAVAIANSVAIVGL
TPLKEKEPFVLRVNDNTGEVDIVTTLKDEQITSLEQTARYYASNFVKLSESYDWYTIQKQFDDLMLFADN
NVQNEIRNKFAMPTAPHKTYGSSQRVDVKINSVSKIGDNLMQIRFTKKISPMNGGTYDVMSGRLSPEPVE
SRHIAVLAYDYVNVPTVDEIRLVNPFGFTVKSYQVNDDGVGQ
 
Nucleotide Sequence: 759 bp     [Download]
>gi|190606581|ref|NC_010900.1|:c20267-19509 Moraxella bovis Epp63 plasmid pMBO-2, complete sequence
ATGTTTAAATCCAAAAAAGCACCAGCCAATAAGGTTCAAAAAGACAAAAAGATAAGCGACAATCAGGCGA
TTAACGATTATCTTAAAGAAGCTCGTGGGTTTGAAAAATCACGCATTGAGTTTGTAGAGAAGTCCAAGAC
TTTTTGGCAGTATGTAGCGTTGGGGGCGGTTGCCGTTGCTATCGCTAACAGCGTGGCAATCGTGGGACTA
ACACCGCTCAAAGAAAAAGAGCCGTTTGTTCTGCGTGTCAATGATAACACAGGCGAAGTGGATATTGTAA
CCACGCTGAAAGATGAGCAAATTACCAGTCTTGAACAAACCGCTCGCTATTATGCGTCCAACTTTGTGAA
GTTGTCAGAAAGCTATGATTGGTACACCATTCAAAAGCAATTTGATGATTTGATGTTGTTTGCTGATAAC
AATGTCCAAAACGAAATTAGAAATAAATTTGCCATGCCAACTGCTCCACACAAAACTTACGGCAGTAGTC
AGCGTGTAGATGTCAAAATCAACAGCGTATCCAAGATTGGCGACAATCTTATGCAAATTCGCTTTACCAA
AAAAATTAGCCCCATGAATGGCGGTACTTACGATGTAATGAGTGGCAGACTATCGCCAGAGCCAGTAGAA
AGCCGTCATATTGCGGTGCTGGCGTACGACTATGTCAATGTGCCAACCGTTGATGAAATCCGCTTAGTGA
ACCCATTTGGCTTCACAGTCAAATCATATCAAGTAAACGATGACGGAGTGGGTCAATGA
 Primer design