SecReT4
Protein ID: 190606607
T4SS name [ID]VirB [428]
Gene symbolvirB7
Locus tagpMBO2_p27
StrainMoraxella bovis Epp63 plasmid pMBO-2 (NC_010900)
Repliconplasmid pMBO-2 [GenBank: NC_010900] [Browse all T4SS(s) in this replicon]
Location [Strand]20317..20457 [-]
ProductVirB7-like protein
Component typeVirB7
UniProt IDQ5KT88
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 46 a.a.     [Download]
>gi|190606607|ref|YP_001966426.1| VirB7-like protein [Moraxella bovis Epp63]
MAFCALTLTACQSVHKPPMPKGAWVAVNQTVLYRQILPNIVMMLAH
 
Nucleotide Sequence: 141 bp     [Download]
>gi|190606581|ref|NC_010900.1|:c20457-20317 Moraxella bovis Epp63 plasmid pMBO-2, complete sequence
ATGGCATTTTGTGCATTGACTTTGACAGCGTGCCAATCCGTTCATAAACCCCCAATGCCAAAGGGAGCGT
GGGTTGCAGTTAATCAGACGGTTTTATACCGCCAAATACTACCAAATATCGTGATGATGTTAGCACATTA
A
 Primer design