SecReT4
Protein ID: 190894134
T4SS name [ID]VirB [223]
Gene symbolvirB7b
Locus tagRHECIAT_PB0000165
StrainRhizobium etli CIAT 652
Repliconplasmid pB [GenBank: NC_010996] [Browse all T4SS(s) in this replicon]
Location [Strand]182635..182916 [+]
Producttransport secretion system IV protein, VirB7
Component typeVirB7
UniProt IDB3Q2H2
KEGG IDrec:RHECIAT_PB0000165
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 93 a.a.     [Download]
>gi|190894134|ref|YP_001984428.1| transport secretion system IV protein, VirB7 [Rhizobium etli CIAT 652]
MLRIVLSFLLTAGLVGCGSMSHPLPKCDGYSRRPLNRAMWQWQDSGGEQPATRAVPAEPTSHAAAYVQEP
SSVTPAAFAHFDVAGSYRPCEGE
 
Nucleotide Sequence: 282 bp     [Download]
>gi|190893983|ref|NC_010996.1|:182635-182916 Rhizobium etli CIAT 652 plasmid pB, complete sequence
ATGCTCCGAATCGTTTTGTCGTTTTTGCTGACCGCCGGTCTCGTAGGCTGCGGTTCGATGTCCCACCCGC
TACCCAAATGTGATGGTTATTCCCGCCGGCCGTTGAACCGCGCCATGTGGCAATGGCAGGACAGTGGAGG
CGAGCAGCCGGCGACCCGGGCCGTTCCCGCTGAGCCGACCAGTCACGCCGCTGCCTATGTGCAGGAGCCG
TCCTCAGTTACGCCGGCCGCTTTCGCGCATTTCGATGTCGCGGGCTCCTACCGTCCATGCGAGGGCGAGT
GA
 Primer design