SecReT4
Protein ID: 190894135
T4SS name [ID]VirB [223]
Gene symbolvirB8b
Locus tagRHECIAT_PB0000166
StrainRhizobium etli CIAT 652
Repliconplasmid pB [GenBank: NC_010996] [Browse all T4SS(s) in this replicon]
Location [Strand]182918..183589 [+]
Producttransport secretion system IV protein, VirB8
Component typeVirB8
UniProt IDB3Q2H3
KEGG IDrec:RHECIAT_PB0000166
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 7.7e-68, Aligned region: 13..220
Protein Sequence: 223 a.a.     [Download]
>gi|190894135|ref|YP_001984429.1| transport secretion system IV protein, VirB8 [Rhizobium etli CIAT 652]
MVTTDNLKSYFDKARRFDQDRMIQVERSARIAWFVAVCASILAAVSVFAVAGLTPLKTVEPFVVRVDNST
GIVDVVSALTSTAGTYDEAVTKYFAAKYVRAREGYVWSEGEENFRTVALLSTQPEQTRFSALYRGSNPDS
PQNIYGRSATSRINIVSISLINANVASVRYMRTVTRGDEVRTTHWVATLTFSYANAPMSSTDRLTNPLGF
VVSEYRADPEAIN
 
Nucleotide Sequence: 672 bp     [Download]
>gi|190893983|ref|NC_010996.1|:182918-183589 Rhizobium etli CIAT 652 plasmid pB, complete sequence
ATGGTGACCACGGATAACCTCAAAAGTTACTTCGACAAGGCCCGCCGGTTCGATCAGGACCGGATGATCC
AGGTCGAGCGTTCCGCCCGCATTGCCTGGTTCGTCGCTGTTTGCGCGAGCATCCTTGCTGCCGTTTCAGT
CTTTGCTGTTGCCGGCCTCACGCCTTTGAAAACCGTCGAGCCCTTCGTCGTGCGGGTCGACAATTCCACC
GGCATCGTCGATGTGGTCTCGGCGCTGACATCCACCGCCGGCACCTACGACGAGGCCGTCACCAAATATT
TCGCGGCCAAATATGTCCGCGCCCGCGAAGGCTATGTCTGGAGCGAGGGCGAGGAGAATTTCCGGACGGT
GGCATTGCTGTCGACGCAGCCGGAGCAAACGCGGTTTTCAGCGCTCTACCGCGGCAGCAATCCCGATTCC
CCGCAGAACATTTATGGCCGCAGCGCCACGTCGCGGATCAACATTGTTTCCATCTCGCTGATCAACGCCA
ATGTGGCATCCGTCCGCTATATGAGGACCGTGACCCGCGGTGACGAGGTGCGCACCACGCACTGGGTTGC
GACCCTGACCTTCTCCTATGCCAACGCTCCGATGTCCTCGACCGACCGGCTGACCAATCCGCTCGGCTTC
GTCGTCAGCGAATATCGCGCCGATCCGGAGGCCATCAATTGA
 Primer design