SecReT4
Protein ID: 190894138
T4SS name [ID]VirB [223]
Gene symbolvirB11b
Locus tagRHECIAT_PB0000169
StrainRhizobium etli CIAT 652
Repliconplasmid pB [GenBank: NC_010996] [Browse all T4SS(s) in this replicon]
Location [Strand]185633..186661 [+]
Producttransport secretion system IV protein, VirB11
Component typeVirB11
UniProt IDB3Q2H6
KEGG IDrec:RHECIAT_PB0000169
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.8e-86, Aligned region: 15..316
AAA_17 [PF13207], Evalue: 6.1e-05, Aligned region: 166..198
AAA_18 [PF13238], Evalue: 6.3e-05, Aligned region: 166..209
Protein Sequence: 342 a.a.     [Download]
>gi|190894138|ref|YP_001984432.1| transport secretion system IV protein, VirB11 [Rhizobium etli CIAT 652]
MTEAADSGVVRELLSPLSRFLRDKTLYEVIVNRPGQVVTEGREGWQTYEMPELSFDRLMRLARSVASFSN
QSIDETRPILSATLPDDERIQIVIPPATTKGTVSITIRKPSSVSLTLEDLDHGGLFADVVPAQDDGRRSD
HRLLEYYRIGAYKAFLREAVFARKNIIISGATGSGKTTLSKALIRHIPQSERIISIEDTPELVVPQPNHV
RLLYSKGGQGLAKVGAKDLLESCLRMRPDRILLQELRDGTAFYYIRNVNSGHPGSITTVHADSARLAFEQ
LTLLVKESEGGGDLERHDIREMLTIAVDIIIQCKRIDGRFRVSEIYYRDVATDLGRSSSDRA
 
Nucleotide Sequence: 1029 bp     [Download]
>gi|190893983|ref|NC_010996.1|:185633-186661 Rhizobium etli CIAT 652 plasmid pB, complete sequence
ATGACTGAAGCTGCCGACTCCGGCGTCGTGCGAGAACTGCTTTCGCCGCTATCACGCTTCCTGCGCGACA
AGACGCTCTATGAGGTCATCGTCAACCGGCCGGGGCAGGTCGTCACGGAGGGTAGGGAGGGATGGCAGAC
TTATGAGATGCCCGAACTCTCTTTCGACAGGTTGATGCGTCTCGCCCGCTCGGTCGCGAGCTTCTCCAAT
CAGTCGATCGACGAGACGCGACCGATCCTGTCGGCGACCTTGCCGGATGATGAGCGAATTCAGATCGTCA
TCCCGCCGGCAACGACGAAGGGAACCGTCAGCATCACCATCCGTAAGCCATCCTCCGTGTCGTTGACCCT
GGAGGATCTCGATCATGGGGGATTGTTCGCCGATGTTGTGCCGGCCCAAGACGACGGGCGACGATCAGAC
CATAGGCTGTTGGAATACTATCGCATCGGTGCCTACAAGGCGTTTCTCCGGGAGGCGGTGTTTGCAAGAA
AGAACATCATCATCTCCGGCGCCACCGGGTCGGGAAAAACAACTCTATCGAAAGCGCTGATCCGCCACAT
TCCGCAAAGCGAGCGGATTATTTCGATCGAAGACACTCCCGAGCTGGTGGTCCCGCAGCCCAACCATGTT
CGGCTCCTTTACTCCAAAGGCGGGCAGGGGCTCGCCAAGGTCGGCGCGAAGGACCTGCTCGAATCCTGCC
TGCGCATGCGGCCCGACCGCATTTTGCTGCAGGAGCTGCGGGACGGGACGGCATTCTACTACATCCGCAA
TGTCAACTCCGGCCATCCTGGCTCCATCACCACGGTCCATGCCGACTCGGCCCGCCTCGCTTTTGAGCAG
CTGACTTTGCTGGTCAAGGAGTCGGAGGGTGGTGGGGACCTCGAACGGCACGACATCCGCGAGATGCTGA
CGATCGCGGTCGACATCATCATCCAATGCAAGCGGATCGACGGCCGGTTTCGGGTGAGCGAGATCTACTA
TCGAGACGTCGCGACTGACCTCGGCCGCTCTTCGTCGGATCGAGCTTAA
 Primer design