SecReT4
Protein ID: 190894151
T4SS name [ID]VirB [223]
Gene symboltraGb
Locus tagRHECIAT_PB0000183
StrainRhizobium etli CIAT 652
Repliconplasmid pB [GenBank: NC_010996] [Browse all T4SS(s) in this replicon]
Location [Strand]194285..196204 [-]
Productconjugal transfer protein TraG
Component typeVirD4
UniProt IDB3Q2I9
KEGG IDrec:RHECIAT_PB0000183
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2e-96, Aligned region: 168..634
TraG-D_C [PF12696], Evalue: 3.1e-30, Aligned region: 473..596
TrwB_AAD_bind [PF10412], Evalue: 4.4e-22, Aligned region: 432..612
Protein Sequence: 639 a.a.     [Download]
>gi|190894151|ref|YP_001984445.1| conjugal transfer protein G [Rhizobium etli CIAT 652]
MGLRGKPHPSLLLVLVPIAVTTITIYIVGWRWPGLAAGMSGKIEHWFLRAAPVPPLLFGPLAGLLTVWAL
PLHRRRPVAMASLLYFLGVAAFYALREFGRLAPAVQAEVITWDRALSYLDMVAVIAAVAGFMAVAMSARI
SVVVPDEIKRARRGIFGDADWLPMTAAGKLFPPEGEIVVGERYRVDKEIVHALPFDANDRSTWGQGGKAP
LLTYRQDFDSTHMLFFAGSGGYKTTSNVVPTALRYSGPLICLDPSTEVAPMVAGHRARALKREVMVLDPT
NPIMGFNVLDGIEASKQKEEDIVGIAHMLLSESLRFESSTGSYFQNQAHNLLTGLLAHVMLSPEYEGRRS
LRSLRQIVSEPEPSVLAMLRDIQEHSGSAFIRETLGVFTNMTEQTFSGVYSTASKDTQWLSLDSYAALVC
GNAFKSSDIVSGKKDVFLNISASILRSYPGIARVIIGSLINAMVQADGAFQRRALFMLDEVDLLGYMRVL
EEARDRGRKYGISMMLMYQSVGQLERHFGKDGATSWIDGCAFASYAAIKALDTARNVSAQCGEMTVEVKG
SSRNIGWDTKNNASRRSENVNFQRRPLIMPHEITQSMRKDEQIIIVQGHSPIRCGRAIYFRRKEMDQAAK
VNRFVKPVL
 
Nucleotide Sequence: 1920 bp     [Download]
>gi|190893983|ref|NC_010996.1|:c196204-194285 Rhizobium etli CIAT 652 plasmid pB, complete sequence
ATGGGCCTAAGAGGGAAACCGCATCCGAGCCTGTTACTCGTTTTGGTACCGATCGCCGTCACCACGATCA
CAATCTACATTGTTGGCTGGCGATGGCCGGGACTCGCCGCCGGCATGTCCGGGAAGATAGAACACTGGTT
CCTGCGCGCAGCACCTGTGCCGCCTCTACTGTTCGGACCTCTTGCCGGACTTCTGACAGTTTGGGCCTTG
CCGCTGCATCGGCGAAGGCCGGTCGCCATGGCAAGCCTTTTGTATTTTCTCGGTGTTGCCGCGTTCTATG
CGCTGCGCGAATTCGGCCGGCTTGCACCTGCTGTGCAGGCCGAAGTGATCACATGGGATCGAGCGCTGTC
CTATCTTGATATGGTCGCAGTCATCGCCGCCGTCGCCGGCTTCATGGCAGTGGCGATGTCGGCCCGCATC
TCCGTCGTCGTCCCAGATGAAATAAAACGTGCCCGGCGTGGAATATTTGGAGATGCCGATTGGCTGCCCA
TGACGGCAGCAGGAAAACTGTTTCCGCCGGAAGGGGAAATCGTCGTCGGTGAGCGCTATCGGGTCGACAA
GGAAATCGTCCATGCGCTTCCCTTCGATGCAAACGATCGTAGCACCTGGGGACAGGGCGGGAAGGCGCCA
TTGCTCACCTACAGACAGGACTTCGATTCCACCCATATGCTGTTTTTCGCGGGATCGGGCGGATACAAGA
CCACCAGCAACGTCGTCCCGACGGCGCTGCGCTATAGCGGGCCGTTGATCTGCCTCGATCCCTCCACCGA
GGTCGCACCAATGGTGGCCGGACACCGAGCCCGCGCCCTCAAGCGCGAGGTCATGGTGCTCGATCCGACG
AACCCGATCATGGGCTTCAACGTGCTCGACGGGATCGAAGCATCCAAGCAAAAGGAAGAGGACATCGTCG
GCATTGCCCATATGCTGCTGTCGGAAAGCCTTCGCTTCGAAAGCTCGACGGGATCCTACTTCCAGAACCA
GGCGCACAACCTCCTGACCGGTCTGCTCGCCCATGTGATGCTCTCGCCCGAATATGAGGGCCGGCGAAGC
TTGCGCAGTCTCCGCCAGATCGTTTCCGAACCGGAGCCCTCGGTGCTCGCTATGCTGCGCGACATTCAGG
AGCATTCCGGTTCGGCCTTCATCCGCGAAACGCTCGGCGTCTTCACCAACATGACCGAGCAGACGTTTTC
GGGCGTCTATTCCACAGCATCGAAGGATACCCAGTGGCTGTCGCTCGACAGCTATGCCGCGCTCGTCTGC
GGCAATGCCTTCAAATCGAGTGATATCGTTTCGGGCAAGAAGGACGTCTTCCTCAACATCTCCGCATCGA
TCCTGCGCTCCTATCCGGGCATCGCTCGTGTGATCATCGGCTCGCTCATCAACGCCATGGTGCAGGCCGA
CGGCGCCTTCCAGCGCCGGGCGCTGTTCATGCTCGATGAGGTCGATCTGCTCGGCTACATGAGGGTGCTC
GAGGAGGCGCGCGACCGCGGCCGCAAGTACGGCATCTCGATGATGTTGATGTACCAGTCGGTCGGGCAGT
TGGAGCGGCATTTCGGGAAGGATGGCGCGACGTCATGGATCGATGGCTGCGCTTTCGCCTCTTACGCAGC
GATCAAGGCGCTCGACACGGCGCGCAACGTCTCTGCGCAATGTGGCGAGATGACGGTGGAAGTGAAGGGC
AGTTCCCGCAACATCGGCTGGGACACGAAGAACAATGCATCCAGGAGATCCGAGAACGTCAACTTCCAGC
GCCGGCCGCTGATCATGCCGCACGAGATCACCCAGTCGATGAGGAAGGACGAGCAGATCATCATCGTCCA
GGGGCATAGTCCGATCCGCTGCGGCCGGGCGATCTACTTCCGGCGAAAGGAGATGGATCAGGCAGCTAAG
GTCAATCGTTTCGTCAAACCGGTGCTATGA
 Primer design