SecReT4
Protein ID: 190895212
T4SS name [ID]VirB [195]
Gene symboltraGc
Locus tagRHECIAT_PC0000885
StrainRhizobium etli CIAT 652
Repliconplasmid pC [GenBank: NC_010997] [Browse all T4SS(s) in this replicon]
Location [Strand]979613..981532 [+]
Productconjugal transfer coupling protein TraG
Component typeVirD4
UniProt IDB3Q3U5
KEGG IDrec:RHECIAT_PC0000885
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 7.2e-93, Aligned region: 165..632
TraG-D_C [PF12696], Evalue: 4.7e-30, Aligned region: 473..596
TrwB_AAD_bind [PF10412], Evalue: 1.6e-22, Aligned region: 446..612
Protein Sequence: 639 a.a.     [Download]
>gi|190895212|ref|YP_001985505.1| conjugal transfer coupling protein TraG [Rhizobium etli CIAT 652]
MIARGKPHPSLLFVFAPVVVTAIAVYIAGWRWPGLAAGMPGRMEYWFLRAAPVPALLFGPLAGLLTVWTL
PLHRRRPVAMTSLLCYLGVSAFYAMREFARLGPSVQTGVITWDRALSYLDMVAVLGAVAGFLAVAVSARI
SVVVPDEINRARRGTFGDADWLSMAAAAKLFPPDGEIVVGERYRVDKEIVHELPFDANDRGTWGQGGKAP
LLTYKQDFDSTHMLFFAGSGGYKTTSNVVPTALRYTGPLICLDPSTEVAPMVVEHRTHALGREVMVLDPT
NPIMGFNVLDGIETSRQKEEDIVGIAHMLLSESVRFESSTGSYFQSQAHNLLTGLLAHVMLSPEYAGRRN
LRSLREIVSEPEPSVLAMLRDIQENSQSDFIRETLGVFTNMTEQTFSGVYSTASKDTQWLSLDSYAALVC
GKAFKPSHIVSGRKDVFLNIPASILRSYPGIGRVIIGSLINAMMQADGAFRRRALFMLDEVDLLGYMRVL
EEARDRGRKYGVSMMLMYQSVGQLERHFGKDGATSWIEGCAFASYAAVKALDTARTVSAQCGEMTVEVKG
SSRNLGWNSRNGGTRKSESVSFQRRPLIMPHEITQSMRKDEQIIIVQGHSPIRCGRAIYFRRKEMDGVAK
ANRFVKPVP
 
Nucleotide Sequence: 1920 bp     [Download]
>gi|190894340|ref|NC_010997.1|:979613-981532 Rhizobium etli CIAT 652 plasmid pC, complete sequence
ATGATAGCGAGAGGGAAGCCGCATCCGAGCCTGCTGTTCGTTTTCGCGCCTGTCGTGGTCACGGCAATTG
CAGTCTACATTGCAGGCTGGCGTTGGCCTGGGCTCGCCGCGGGCATGCCGGGAAGGATGGAATACTGGTT
CCTGCGAGCCGCACCTGTGCCGGCGCTGCTGTTCGGGCCGCTCGCCGGACTACTGACCGTCTGGACCTTG
CCGCTGCATCGGCGAAGGCCGGTCGCCATGACAAGCCTTCTGTGTTATCTGGGCGTCTCCGCCTTCTATG
CCATGCGCGAATTCGCCCGGCTTGGACCTTCGGTGCAAACCGGGGTCATCACATGGGATCGAGCGCTATC
CTATCTTGATATGGTCGCAGTCCTCGGCGCTGTCGCGGGATTCCTGGCAGTGGCGGTATCGGCCCGCATC
TCCGTCGTCGTGCCGGATGAGATCAACCGCGCCCGGCGCGGAACGTTCGGGGACGCCGACTGGCTGTCCA
TGGCTGCGGCCGCAAAACTGTTTCCGCCCGATGGGGAGATCGTCGTCGGCGAGCGCTATCGGGTCGACAA
GGAAATCGTCCATGAGCTTCCCTTCGATGCAAACGATCGCGGCACATGGGGACAGGGCGGCAAGGCGCCG
CTGCTGACATACAAGCAGGACTTCGATTCCACCCACATGCTGTTTTTCGCGGGATCGGGCGGATACAAGA
CGACCAGCAACGTTGTGCCGACGGCGCTCAGATATACCGGGCCCCTAATCTGCCTCGATCCCTCCACCGA
GGTGGCGCCCATGGTCGTCGAGCACCGCACCCATGCGCTCGGGCGCGAGGTGATGGTGCTCGATCCCACA
AACCCGATCATGGGCTTCAACGTGCTTGACGGGATAGAGACGTCGCGCCAAAAGGAAGAGGATATTGTCG
GCATCGCGCATATGCTGCTATCGGAGAGCGTGCGCTTCGAAAGCTCGACCGGCTCCTATTTCCAGAGTCA
GGCGCACAATCTGCTGACGGGGCTGCTTGCTCATGTGATGCTGTCGCCGGAATATGCCGGCCGGCGGAAT
CTGCGAAGCTTGAGGGAGATCGTCTCGGAGCCGGAGCCCTCGGTGCTCGCCATGCTGCGCGACATTCAGG
AGAACTCGCAATCGGACTTCATCCGCGAAACTCTGGGTGTCTTCACCAACATGACCGAGCAGACCTTCAG
CGGCGTCTATTCCACAGCATCGAAGGACACGCAGTGGCTCTCGCTCGATAGTTATGCCGCGCTGGTCTGC
GGCAAAGCCTTCAAGCCGAGCCATATCGTCAGCGGTCGAAAAGACGTCTTCCTGAATATCCCGGCTTCTA
TCTTGCGCTCCTATCCGGGGATCGGTCGAGTCATCATCGGCTCGCTGATCAACGCCATGATGCAGGCCGA
CGGCGCTTTCCGGCGCCGGGCATTGTTCATGCTCGATGAGGTCGATCTGCTCGGCTACATGCGCGTGCTG
GAGGAAGCGCGCGATCGCGGGCGCAAATATGGGGTGTCGATGATGTTGATGTACCAATCGGTGGGACAGC
TGGAACGACACTTCGGAAAAGATGGGGCGACGTCGTGGATCGAGGGCTGCGCTTTCGCGAGCTATGCGGC
GGTCAAGGCGCTCGACACCGCCCGCACCGTCTCGGCCCAATGTGGCGAGATGACCGTCGAGGTAAAAGGC
AGTTCACGCAATCTCGGCTGGAACAGCCGGAACGGCGGCACGCGGAAATCGGAGAGCGTCAGTTTCCAAC
GCCGGCCGCTGATCATGCCGCATGAAATCACCCAGTCGATGCGCAAGGACGAGCAGATCATCATCGTGCA
GGGCCATAGTCCGATCCGCTGCGGACGCGCGATCTATTTCCGGCGCAAGGAGATGGATGGGGTTGCCAAG
GCGAACCGCTTCGTCAAACCGGTGCCTTGA
 Primer design