SecReT4
Protein ID: 190895227
T4SS name [ID]VirB [195]
Gene symbolvirB11c
Locus tagRHECIAT_PC0000900
StrainRhizobium etli CIAT 652
Repliconplasmid pC [GenBank: NC_010997] [Browse all T4SS(s) in this replicon]
Location [Strand]990864..991859 [-]
Producttransport secretion system IV protein, VirB11
Component typeVirB11
UniProt IDB3Q3W0
KEGG IDrec:RHECIAT_PC0000900
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.4e-84, Aligned region: 15..316
AAA_17 [PF13207], Evalue: 9e-05, Aligned region: 166..198
Protein Sequence: 331 a.a.     [Download]
>gi|190895227|ref|YP_001985520.1| transport secretion system IV protein, VirB11 [Rhizobium etli CIAT 652]
MTEAPDSAVVRELLSPLSPFLRDKTFYEVIVNRPGQVVTEGGEGWQTYDMAELSYDRLMRLARAVASFSN
QSIDETRPILSATLPDGERIQIVIPPATTKGTVSITIRKPSSVSLTLEDLDHGGLFADVALAEGDGGRWD
KSLLDYYRVGAYKAFLREAVFARKNIIISGATGSGKTTLSKALIRYIPQSERIISIEDTPELVVPQPNHV
RLFYSKGGQGLAKVGAKDLLESCLRMRPDRILLQELRDGTAFYYIRNINSGHPGSITTVHADSTRLAFEQ
LTLLVKESEGGGDLERHDIREMLTIAVDIIVQCKRIDGRFRVSEIYYRDAE
 
Nucleotide Sequence: 996 bp     [Download]
>gi|190894340|ref|NC_010997.1|:c991859-990864 Rhizobium etli CIAT 652 plasmid pC, complete sequence
ATGACCGAAGCTCCGGACTCCGCAGTCGTGCGCGAATTGCTTTCGCCTCTCTCGCCGTTCCTTCGCGACA
AGACGTTCTATGAGGTCATCGTCAATCGACCCGGGCAAGTCGTCACGGAGGGCGGGGAGGGATGGCAGAC
CTACGACATGGCGGAACTATCCTACGACAGGCTGATGCGTCTCGCGCGGGCGGTCGCGAGTTTTTCCAAT
CAATCGATCGACGAGACACGGCCGATCCTGTCGGCGACCTTGCCGGATGGCGAGCGGATCCAGATCGTCA
TTCCGCCGGCAACGACGAAGGGAACCGTCAGCATCACCATACGCAAGCCATCCTCCGTGTCGCTGACCCT
CGAGGATCTCGACCATGGAGGATTGTTCGCCGATGTCGCGCTGGCCGAAGGCGACGGAGGGCGATGGGAC
AAAAGCCTGTTGGATTACTATCGGGTCGGCGCCTATAAGGCGTTTCTCCGGGAGGCGGTGTTTGCAAGAA
AGAACATCATCATTTCCGGCGCCACGGGCTCTGGAAAGACCACCCTGTCGAAAGCGCTGATCCGTTATAT
TCCGCAAAGCGAGCGGATCATTTCGATCGAAGACACACCGGAGCTGGTGGTCCCGCAGCCCAATCACGTT
CGGCTCTTTTATTCCAAGGGCGGGCAGGGGCTCGCCAAAGTCGGCGCCAAGGACCTGCTCGAATCCTGTC
TGCGCATGCGGCCCGACCGCATCCTGCTGCAGGAGCTGCGAGACGGCACGGCTTTCTACTACATTCGCAA
CATCAACTCCGGCCATCCGGGCTCGATCACGACGGTTCACGCCGATTCCACCCGGCTCGCCTTCGAGCAA
CTGACATTGCTGGTCAAGGAGTCGGAAGGCGGCGGGGACCTCGAGCGGCACGACATCCGCGAGATGCTGA
CGATTGCTGTCGATATCATTGTTCAATGCAAGCGGATTGATGGCCGCTTTCGGGTAAGCGAGATCTACTA
TCGAGATGCCGAATGA
 Primer design