SecReT4
Protein ID: 190895228
T4SS name [ID]VirB [195]
Gene symbolvirB10c
Locus tagRHECIAT_PC0000901
StrainRhizobium etli CIAT 652
Repliconplasmid pC [GenBank: NC_010997] [Browse all T4SS(s) in this replicon]
Location [Strand]991868..993043 [-]
Producttransport secretion system IV protein, VirB10
Component typeVirB10
UniProt IDB3Q3W1
KEGG IDrec:RHECIAT_PC0000901
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 8.5e-60, Aligned region: 184..358
Protein Sequence: 391 a.a.     [Download]
>gi|190895228|ref|YP_001985521.1| transport secretion system IV protein, VirB10 [Rhizobium etli CIAT 652]
MVEEEIIQIPGERAETSAGGRLDNNPILKRGAVAVAMVVFVAFALWSMRGQDKPSDSAQPERVVIRQTSD
FEPAKEPVQPTATLPQVQLPTPVATEQAPTDDDKLLDAARRAPVIAYGGEKAPSTRRQDQDRTSDQASDY
VQLGANPGGFASQGENEDQRFSRLLTPTQLQGSRAGTLGNRDFIVAMGTSIPCVLETALSSDQPGFTSCV
INRDVLSDNGRVVLMEKGTQVVGEYRGGIRRGQKRLFVLWNRAKTPKGVIITLASPATDALGRAGVDGYV
DTHWWERFGSAILLSIVGDTTSYASSRLQDSDVEAQNTTSAGQQAAAIAVEQSINIAPTLMKHQGELVSI
FVARDLDFSSVYRLRVTEPGNRIYDRAVLGDFAPTSKIVTK
 
Nucleotide Sequence: 1176 bp     [Download]
>gi|190894340|ref|NC_010997.1|:c993043-991868 Rhizobium etli CIAT 652 plasmid pC, complete sequence
ATGGTCGAGGAAGAGATTATCCAGATCCCCGGTGAGCGCGCCGAGACGTCGGCCGGCGGCCGGCTCGACA
ACAATCCCATCCTCAAACGCGGCGCTGTCGCTGTCGCGATGGTGGTCTTTGTCGCCTTCGCGCTCTGGTC
GATGCGCGGGCAGGACAAACCGTCGGATAGTGCCCAGCCCGAACGGGTGGTCATCCGCCAGACTTCGGAT
TTCGAACCGGCCAAGGAGCCGGTCCAGCCGACAGCGACTCTGCCGCAGGTCCAGCTCCCGACGCCTGTTG
CTACCGAACAGGCGCCGACGGACGATGACAAACTGCTCGATGCTGCCCGCCGTGCGCCGGTCATCGCTTA
TGGCGGCGAGAAGGCGCCGTCGACTCGGCGCCAGGATCAGGACAGGACCTCGGATCAAGCCTCGGACTAC
GTGCAGCTCGGCGCCAATCCCGGCGGCTTCGCCTCGCAGGGCGAAAACGAAGACCAGCGCTTCAGCCGCT
TGCTGACGCCGACGCAGTTGCAGGGATCGCGCGCCGGCACGCTGGGCAACCGCGATTTCATCGTCGCGAT
GGGGACATCCATTCCTTGCGTTCTCGAGACCGCGCTCTCCTCCGATCAGCCGGGGTTCACCAGCTGCGTC
ATCAACCGCGACGTTCTTTCGGATAACGGCCGCGTCGTGCTGATGGAAAAAGGCACGCAGGTCGTCGGTG
AATATCGCGGCGGCATCCGCCGTGGACAGAAGCGCCTGTTCGTCCTCTGGAACCGGGCGAAGACCCCGAA
GGGCGTGATCATCACTTTGGCGTCGCCGGCAACCGATGCCCTCGGCCGGGCCGGCGTCGACGGCTATGTC
GACACCCATTGGTGGGAGCGTTTCGGCAGCGCGATCCTGCTGTCGATCGTCGGCGACACGACCTCCTACG
CCAGCAGCCGGCTGCAGGACAGCGATGTCGAAGCGCAAAACACCACCAGCGCCGGCCAGCAGGCCGCGGC
GATCGCCGTCGAGCAATCGATCAACATTGCGCCGACCCTCATGAAGCATCAGGGCGAGCTGGTTTCGATC
TTCGTCGCGCGTGATCTCGATTTCTCCAGCGTCTACCGGCTTCGCGTAACGGAGCCCGGCAACCGCATCT
ACGACCGCGCCGTGCTCGGAGATTTCGCGCCGACGTCGAAGATCGTGACAAAATAG
 Primer design