SecReT4
Protein ID: 190895229
T4SS name [ID]VirB [195]
Gene symbolvirB9c
Locus tagRHECIAT_PC0000902
StrainRhizobium etli CIAT 652
Repliconplasmid pC [GenBank: NC_010997] [Browse all T4SS(s) in this replicon]
Location [Strand]993052..993906 [-]
Producttransport secretion system IV protein, VirB9
Component typeVirB9
UniProt IDB3Q3W2
KEGG IDrec:RHECIAT_PC0000902
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.1e-59, Aligned region: 31..255
Protein Sequence: 284 a.a.     [Download]
>gi|190895229|ref|YP_001985522.1| transport secretion system IV protein, VirB9 [Rhizobium etli CIAT 652]
MRSHVFLPLILAGSLSSPVLALETPRGAAQDSRIRFVDYQPYNITKVVGTLRSSVQIEFAADEEIAHVAL
GNSVAWEVAPAGNILFLKPRENQPVTNISVVTTRRDGSTRSYQMELTVRDGSVEAGQNTYFYVKYRYPAD
EAERRRQEAVTRAQAAQAGEADRVLALHEAFGPRNWRYSAQGSQALEPQAVYDNGKVTSFAFVGNQEMPA
IYMENSDGSESLVPKSVDGNLVLVHAISRKFILRRGGDVLCVFNEAYDRVGINPETNTTSPSVKRVVKAP
QDAQ
 
Nucleotide Sequence: 855 bp     [Download]
>gi|190894340|ref|NC_010997.1|:c993906-993052 Rhizobium etli CIAT 652 plasmid pC, complete sequence
TTGAGATCGCACGTTTTCCTTCCGCTTATCCTTGCCGGCAGCCTCTCCTCGCCGGTGCTCGCCCTCGAAA
CGCCACGCGGTGCGGCGCAGGATAGCCGCATTCGCTTCGTCGATTATCAGCCCTATAACATCACCAAGGT
GGTCGGCACGCTCCGCTCCTCCGTTCAGATCGAATTCGCCGCCGATGAAGAAATCGCCCATGTCGCGCTC
GGCAACAGCGTTGCGTGGGAGGTGGCGCCGGCCGGCAACATTCTTTTCCTGAAGCCTCGGGAAAATCAGC
CTGTGACGAATATCTCGGTCGTCACGACACGGCGGGATGGATCGACCCGCAGCTATCAGATGGAGCTCAC
CGTCCGTGACGGCAGCGTCGAGGCCGGGCAGAACACCTATTTCTATGTGAAATATCGCTACCCAGCTGAC
GAAGCCGAGCGGCGCCGGCAGGAGGCAGTTACGCGAGCCCAGGCGGCGCAGGCCGGCGAGGCCGATCGCG
TACTTGCCCTTCATGAAGCTTTTGGACCGCGCAATTGGCGCTATTCGGCGCAGGGATCCCAGGCGCTCGA
GCCGCAAGCCGTTTATGACAACGGCAAGGTCACGAGCTTCGCCTTTGTCGGCAACCAGGAAATGCCGGCG
ATCTATATGGAAAACTCCGACGGCAGCGAAAGCCTGGTTCCGAAGTCCGTAGACGGAAATCTCGTCCTCG
TTCATGCGATCAGCCGCAAGTTCATCCTGCGCCGGGGAGGCGACGTCCTCTGCGTCTTCAACGAAGCCTA
CGATCGCGTCGGCATCAATCCCGAGACCAACACGACGTCACCGTCGGTCAAGCGCGTCGTCAAGGCGCCG
CAAGATGCGCAATAG
 Primer design