SecReT4
Protein ID: 190895230
T4SS name [ID]VirB [195]
Gene symbolvirB8c
Locus tagRHECIAT_PC0000903
StrainRhizobium etli CIAT 652
Repliconplasmid pC [GenBank: NC_010997] [Browse all T4SS(s) in this replicon]
Location [Strand]993903..994574 [-]
Producttransport secretion system IV protein, VirB8
Component typeVirB8
UniProt IDB3Q3W3
KEGG IDrec:RHECIAT_PC0000903
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.1e-68, Aligned region: 13..220
Protein Sequence: 223 a.a.     [Download]
>gi|190895230|ref|YP_001985523.1| transport secretion system IV protein, VirB8 [Rhizobium etli CIAT 652]
MVTTDSLKSYFEKARRFDQERMMQVERSARIAWFVAVSAGALAAASVFAIAGLTPLKTVEPFVVRVDNST
GIVDVVSALTSTAGTYDEAVTKYFAAKYVRAREGYVWSEGEENFRTVALLSTQPEQTRFSALYRGSNPDS
PQNIYGRSATSRINIVSISLINANVASVRYMRTVTRGDEVRTTHWVATLTFSYANAPMSSTDRLINPLGF
VVSEYRADPEAIN
 
Nucleotide Sequence: 672 bp     [Download]
>gi|190894340|ref|NC_010997.1|:c994574-993903 Rhizobium etli CIAT 652 plasmid pC, complete sequence
ATGGTGACCACGGACAGCCTCAAAAGTTACTTCGAAAAGGCCCGCCGGTTCGATCAGGAACGGATGATGC
AGGTTGAACGTTCCGCCCGCATTGCCTGGTTCGTCGCCGTTTCCGCCGGCGCCCTTGCTGCTGCCTCCGT
CTTTGCCATTGCCGGCCTCACGCCTCTGAAAACTGTCGAACCCTTCGTCGTGCGGGTCGACAATTCAACA
GGCATCGTCGACGTGGTCTCGGCGCTGACATCCACCGCCGGCACCTACGACGAGGCCGTCACCAAATATT
TTGCGGCCAAATACGTCCGCGCCCGCGAAGGTTACGTCTGGAGCGAGGGCGAGGAGAATTTCCGGACGGT
GGCATTGCTGTCGACGCAGCCGGAGCAAACGCGGTTTTCAGCACTCTATCGCGGCAGCAATCCGGATTCG
CCGCAGAACATTTATGGCCGCAGCGCGACCTCGCGGATCAACATCGTTTCCATCTCGCTGATCAACGCCA
ACGTTGCATCCGTCCGCTATATGAGGACCGTGACCCGTGGTGACGAGGTGCGCACCACGCACTGGGTTGC
GACCCTGACCTTTTCCTACGCCAACGCGCCGATGTCCTCAACCGATCGGCTGATCAATCCGCTCGGCTTC
GTCGTCAGCGAATATCGCGCCGATCCGGAGGCCATCAATTGA
 Primer design