SecReT4
Protein ID: 190895231
T4SS name [ID]VirB [195]
Gene symbolvirB7c
Locus tagRHECIAT_PC0000904
StrainRhizobium etli CIAT 652
Repliconplasmid pC [GenBank: NC_010997] [Browse all T4SS(s) in this replicon]
Location [Strand]994568..994855 [-]
Producttransport secretion system IV protein, VirB7
Component typeVirB7
UniProt IDB3Q3W4
KEGG IDrec:RHECIAT_PC0000904
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 95 a.a.     [Download]
>gi|190895231|ref|YP_001985524.1| transport secretion system IV protein, VirB7 [Rhizobium etli CIAT 652]
MIRIVLSLLLTIGLAGCGSISHPLPKCDGYSRRQLNRAMWQWHDNGFGQPSTGAGPAEPTSLAASYVPAP
SAPAPAAFGHFDVAGSYRPCEGVTW
 
Nucleotide Sequence: 288 bp     [Download]
>gi|190894340|ref|NC_010997.1|:c994855-994568 Rhizobium etli CIAT 652 plasmid pC, complete sequence
ATGATCCGCATCGTTTTATCGCTTTTGCTGACTATTGGCCTCGCAGGCTGCGGGTCAATTTCCCACCCGC
TGCCGAAATGTGATGGTTACTCCCGCCGACAACTCAACCGCGCCATGTGGCAGTGGCACGACAATGGATT
CGGGCAGCCCTCGACCGGAGCCGGTCCCGCGGAGCCGACGAGCCTTGCCGCCTCCTATGTGCCGGCCCCT
TCCGCCCCCGCGCCGGCCGCCTTCGGACATTTCGATGTCGCGGGTTCCTACCGTCCATGCGAGGGCGTGA
CATGGTGA
 Primer design