SecReT4
Protein ID: 190895232
T4SS name [ID]VirB [195]
Gene symbolvirB6c
Locus tagRHECIAT_PC0000905
StrainRhizobium etli CIAT 652
Repliconplasmid pC [GenBank: NC_010997] [Browse all T4SS(s) in this replicon]
Location [Strand]994896..995828 [-]
Producttransport secretion system IV protein, VirB6
Component typeVirB6
UniProt IDB3Q3W5
KEGG IDrec:RHECIAT_PC0000905
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 6.3e-55, Aligned region: 39..260
Protein Sequence: 310 a.a.     [Download]
>gi|190895232|ref|YP_001985525.1| transport secretion system IV protein, VirB6 [Rhizobium etli CIAT 652]
MYQVFSFVDGQFKTPLENFISSGTSNIASWVSGPLTAALTLYVVLYGYLVLRGSVQEPILEFAFRAMKLA
IIVMLVRNASDYQTYVTNIFFDALPREISQALNSGTVPSASTFDSLLDKGQNCAHEIWSRASWPVDIVTG
IGGMMVIGASFVVAAIGYIVSLYARLALAVVLAIGPIFIALAMFQSTRRFTESWIGQLVNFVILQVLVVA
IGSLLITCIDTTFTAIESYSDVLMRPVALSAICVAALYVFYQLPGIASALAAGGASLTYGYGAARDAHES
TLAWATSHTARAVGRGGRSVGRRLTPGRSE
 
Nucleotide Sequence: 933 bp     [Download]
>gi|190894340|ref|NC_010997.1|:c995828-994896 Rhizobium etli CIAT 652 plasmid pC, complete sequence
ATGTATCAGGTCTTCAGCTTCGTCGACGGACAATTCAAGACACCGCTGGAAAATTTCATTTCCTCCGGCA
CCTCGAATATCGCCAGCTGGGTCAGCGGCCCGCTGACGGCGGCACTCACGCTCTATGTCGTGCTCTACGG
TTATCTCGTTCTACGCGGCTCCGTCCAGGAGCCGATCCTCGAATTCGCCTTCCGGGCGATGAAGCTGGCG
ATCATCGTCATGCTGGTCAGGAACGCCAGCGATTATCAGACCTATGTCACCAATATCTTCTTCGACGCGT
TGCCCCGCGAGATATCGCAGGCGCTGAACTCCGGCACGGTACCGAGCGCCTCCACATTCGACAGCCTGCT
CGACAAGGGCCAGAATTGCGCCCACGAGATATGGTCCCGCGCCTCCTGGCCGGTCGACATCGTCACCGGC
ATCGGCGGCATGATGGTAATCGGCGCGAGCTTCGTCGTGGCGGCGATCGGCTATATCGTCTCGCTCTATG
CCCGGCTGGCGCTTGCCGTCGTGCTGGCGATCGGTCCGATCTTCATCGCGCTCGCAATGTTCCAGTCCAC
CCGACGCTTCACGGAATCCTGGATCGGCCAGCTTGTCAATTTCGTCATCCTGCAGGTGCTTGTCGTTGCC
ATCGGCTCGCTGCTGATCACCTGCATCGATACAACGTTTACGGCGATCGAAAGCTATAGCGACGTGCTGA
TGCGTCCGGTCGCGCTCAGCGCCATCTGCGTTGCCGCTCTCTACGTCTTCTACCAGCTGCCTGGCATCGC
TTCAGCACTTGCGGCGGGTGGAGCGTCGCTCACCTACGGCTATGGCGCTGCTCGCGATGCGCACGAAAGC
ACGCTCGCCTGGGCGACATCCCATACCGCCAGGGCGGTCGGCCGCGGCGGGCGTTCCGTCGGCCGCCGCC
TGACGCCCGGCAGGAGTGAATGA
 Primer design