SecReT4
Protein ID: 190895234
T4SS name [ID]VirB [195]
Gene symbolvirB5c
Locus tagRHECIAT_PC0000907
StrainRhizobium etli CIAT 652
Repliconplasmid pC [GenBank: NC_010997] [Browse all T4SS(s) in this replicon]
Location [Strand]996061..996762 [-]
Producttransport secretion system IV protein, VirB5
Component typeVirB5
UniProt IDB3Q3W7
KEGG IDrec:RHECIAT_PC0000907
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 8.5e-55, Aligned region: 27..219
OmpH [PF03938], Evalue: 1.9e-06, Aligned region: 14..219
Protein Sequence: 233 a.a.     [Download]
>gi|190895234|ref|YP_001985527.1| transport secretion system IV protein, VirB5 [Rhizobium etli CIAT 652]
MIRTGTMRPLSVSAALLASAMLASAQGIPVIDQTSIAKQIESITQLKSQLDALNQQLQQAQQLYGSLNKI
TNMADIASLLNDPSIRKALPQDFNAIEGLFKGSGSGVFGNSASKFLQDNSTYRTDADDFYARELSRIQNQ
NAGQMSLGQQIYDAATKRIDGIDELRQKISSAADAKDIADLQARLQAETAFLQTDLLRMQGLQMVQQAQV
QVDEQRKAEDWRKRMDTMGAALK
 
Nucleotide Sequence: 702 bp     [Download]
>gi|190894340|ref|NC_010997.1|:c996762-996061 Rhizobium etli CIAT 652 plasmid pC, complete sequence
ATGATCCGAACAGGAACGATGCGCCCATTGTCTGTATCTGCCGCTCTTTTGGCGTCGGCGATGCTGGCAT
CGGCCCAGGGCATCCCGGTCATCGATCAGACATCGATCGCCAAGCAGATCGAAAGCATCACGCAGCTGAA
GTCCCAGCTCGACGCCTTGAACCAGCAGCTCCAGCAAGCCCAGCAGCTCTATGGATCGCTGAACAAGATC
ACCAATATGGCCGACATCGCCAGCCTGCTGAACGATCCGTCGATCCGCAAGGCGCTGCCGCAGGACTTCA
ACGCGATCGAGGGGCTGTTCAAAGGTTCCGGCAGCGGCGTCTTCGGCAATTCCGCTTCGAAATTCCTGCA
GGACAATTCCACCTATCGCACCGATGCCGACGATTTCTATGCGCGGGAGCTGTCGCGCATCCAGAACCAG
AACGCCGGGCAGATGAGCTTGGGACAGCAGATCTACGATGCCGCGACCAAGCGCATCGACGGTATCGACG
AGCTTCGCCAGAAGATCTCAAGTGCGGCCGACGCAAAGGACATTGCCGACCTTCAAGCGCGCCTGCAGGC
CGAAACCGCCTTCCTGCAAACCGACCTCCTGCGCATGCAGGGCCTGCAGATGGTCCAGCAGGCCCAGGTG
CAGGTCGATGAGCAGCGCAAGGCCGAGGATTGGCGCAAGCGCATGGACACGATGGGAGCGGCACTCAAAT
GA
 Primer design