SecReT4
Protein ID: 190895235
T4SS name [ID]VirB [195]
Gene symbolvirB4c
Locus tagRHECIAT_PC0000908
StrainRhizobium etli CIAT 652
Repliconplasmid pC [GenBank: NC_010997] [Browse all T4SS(s) in this replicon]
Location [Strand]996759..999125 [-]
Producttransport secretion system IV protein, VirB4
Component typeVirB4
UniProt IDB3Q3W8
KEGG IDrec:RHECIAT_PC0000908
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 2.7e-63, Aligned region: 178..380
AAA_10 [PF12846], Evalue: 3e-34, Aligned region: 433..711
AAA_22 [PF13401], Evalue: 1.7e-05, Aligned region: 435..462
Protein Sequence: 788 a.a.     [Download]
>gi|190895235|ref|YP_001985528.1| transport secretion system IV protein, VirB4 [Rhizobium etli CIAT 652]
MANIATLRSRELGPETFIPYVRHVDETTIALESRALMTMIALDGVSFETSDIRDLNGLHRNLNTLYRNIA
DERLALWTHVVRRRDNAYPDGRFANAFSDGLNAKYRHRMVREDLFRNDLYLTLVWHPGRDPAERAANLLS
RLRKARRSGIELDEHALKHLRDRVADLVAGLQRFEPRLLSLHEQDGILFSEPSEVLHQLVGGRQEPIALT
EGRISSAIYSDRVIFGRETVEIRHEADSRYAGMFGLKEYPATTRSGMLDAILTAPFELILTQSFAFASKA
DARTIMGRKQNQMVSAGDKAASQIEELGDAMDDLESNRFALGEHHLALAVFAPSVKQLTDHMAKARAYLT
SGGAVVAREDLGLEAAWWAQLPGNFRYRARSGAITSRNFAALAPYHSYPTGQKDGNEWGPAVAMLKTASG
SPFYFNFHHGDLGNTFVCGPSGAGKTVLLNFMLSQLEKHDAHMVFFDKDRGADLFVRAAGGTYLPLKNGA
ATGCAPLKALELTAENKVFLTGWIAKLVGSASGELSITELRDIASAIDGVADLPVEHRSIGALRAFLNNT
DPEGIASRLRRWERGEQLGWVFDNEADDIGIGARFIGYDMTDFLDNEEIRTPLMAYLFYRIEQLIDGRRI
IIVIDEFWKALQDEGFRDLAQNKLKTIRKQNGLMLFATQSPRDAIVSPIAHTIIEQCPTQIFLPNPRGDR
ADYVDGFKLTEREFELVSRELSVESRRFIVKQGHNSVVAELNLSGFDDELAILSGRTANVELADAIRSEI
GEGPEDWLTVFHQRRKTA
 
Nucleotide Sequence: 2367 bp     [Download]
>gi|190894340|ref|NC_010997.1|:c999125-996759 Rhizobium etli CIAT 652 plasmid pC, complete sequence
TTGGCTAATATCGCGACGCTGCGGTCGCGCGAGCTCGGGCCGGAGACCTTCATCCCCTATGTCAGGCATG
TCGACGAAACGACCATCGCGCTCGAGTCCCGAGCGTTGATGACGATGATCGCTCTCGACGGCGTTTCCTT
CGAAACATCAGACATCAGGGACCTTAACGGCCTGCACCGCAATCTGAACACACTCTACCGCAATATCGCC
GACGAGCGGCTGGCGCTCTGGACGCATGTCGTGCGCCGCCGTGACAATGCCTATCCAGATGGCCGCTTCG
CCAACGCCTTCTCCGACGGACTCAATGCCAAATACCGCCACCGGATGGTGCGCGAAGATCTGTTTCGCAA
CGATCTCTACCTGACCCTCGTCTGGCACCCCGGCCGGGATCCTGCCGAAAGGGCGGCCAACCTTCTCTCC
CGGCTGCGCAAGGCGCGCCGATCCGGTATCGAACTCGACGAACATGCCCTGAAGCATCTCCGCGACCGCG
TGGCGGACCTTGTCGCCGGCCTGCAGCGCTTCGAGCCGCGGCTGCTGAGCCTTCATGAACAGGACGGTAT
CCTGTTCTCCGAACCGAGCGAGGTTCTCCACCAGTTGGTCGGCGGCCGTCAGGAACCGATCGCGTTGACG
GAGGGACGGATTTCCTCGGCGATCTATTCCGACCGGGTCATTTTCGGGCGCGAGACCGTCGAGATCCGTC
ACGAGGCCGACAGCCGTTACGCCGGCATGTTCGGCCTCAAGGAATATCCGGCGACCACGCGCAGCGGCAT
GCTCGACGCTATCCTGACCGCACCCTTCGAACTCATCCTGACGCAATCCTTCGCCTTCGCCTCAAAAGCC
GATGCCCGCACGATCATGGGCCGCAAGCAGAACCAGATGGTCAGCGCCGGTGACAAGGCGGCCTCGCAGA
TCGAGGAACTCGGCGACGCGATGGACGATCTCGAATCCAATCGCTTTGCGCTCGGAGAGCATCATTTGGC
ACTTGCCGTTTTCGCGCCGTCGGTCAAGCAACTGACCGACCACATGGCGAAGGCGCGCGCGTATCTCACC
AGCGGCGGCGCGGTCGTCGCCCGCGAGGATCTCGGGCTCGAGGCTGCCTGGTGGGCGCAGCTGCCGGGCA
ATTTCCGCTATCGGGCGCGCTCGGGAGCAATCACGTCCCGCAACTTCGCAGCCCTTGCTCCCTATCATTC
CTATCCCACCGGCCAGAAGGACGGCAACGAGTGGGGACCGGCGGTCGCCATGCTGAAGACCGCATCGGGT
TCGCCCTTCTATTTCAATTTCCATCACGGCGACCTCGGCAACACCTTCGTTTGCGGCCCATCGGGTGCTG
GCAAGACAGTGCTGTTGAACTTCATGCTGTCCCAGCTCGAAAAGCACGATGCGCATATGGTCTTCTTCGA
CAAGGACCGCGGCGCCGATCTCTTCGTACGCGCGGCCGGCGGCACCTATCTCCCGCTGAAGAATGGTGCT
GCCACCGGCTGCGCGCCGTTGAAAGCTCTGGAACTCACTGCGGAAAACAAGGTATTCCTCACCGGTTGGA
TCGCCAAGCTGGTCGGATCCGCATCCGGCGAACTATCGATCACCGAGTTGCGCGACATCGCCTCGGCGAT
CGACGGGGTGGCGGACCTGCCGGTGGAGCATCGCTCCATCGGCGCCCTGCGCGCCTTCCTCAACAATACC
GATCCCGAGGGCATTGCCTCACGTCTGAGACGCTGGGAGAGGGGCGAGCAACTTGGCTGGGTCTTCGACA
ACGAAGCCGACGATATCGGCATCGGCGCCAGGTTCATCGGCTACGACATGACCGATTTCCTTGATAACGA
GGAAATCCGCACGCCGTTGATGGCTTACCTGTTCTATCGCATCGAGCAACTGATTGACGGGCGCCGTATC
ATCATCGTCATCGACGAGTTTTGGAAGGCGCTGCAGGACGAAGGTTTTCGTGATCTCGCCCAGAACAAGC
TGAAGACGATCCGCAAGCAGAACGGTCTCATGCTGTTTGCGACCCAGAGCCCGCGCGACGCCATCGTATC
GCCGATCGCCCACACGATCATCGAGCAGTGCCCGACCCAGATCTTTCTGCCGAACCCGCGCGGCGACCGG
GCCGACTACGTCGACGGTTTCAAGCTGACCGAACGTGAATTCGAGCTCGTCTCGCGCGAGCTCTCCGTCG
AGAGCCGCCGGTTCATCGTCAAGCAGGGGCACAACAGCGTTGTTGCCGAATTGAACCTCAGCGGCTTCGA
CGACGAGCTCGCCATCCTCTCCGGCCGGACGGCCAATGTCGAGCTCGCCGATGCGATCCGATCGGAGATC
GGCGAGGGACCGGAGGACTGGCTCACCGTGTTTCATCAGAGGAGGAAGACAGCATGA
 Primer design