SecReT4
Protein ID: 190895236
T4SS name [ID]VirB [195]
Gene symbolvirB3c
Locus tagRHECIAT_PC0000909
StrainRhizobium etli CIAT 652
Repliconplasmid pC [GenBank: NC_010997] [Browse all T4SS(s) in this replicon]
Location [Strand]999118..999456 [-]
Producttransport secretion system IV protein, VirB3
Component typeVirB3
UniProt IDB3Q3W9
KEGG IDrec:RHECIAT_PC0000909
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 6.9e-20, Aligned region: 9..92
Protein Sequence: 112 a.a.     [Download]
>gi|190895236|ref|YP_001985529.1| transport secretion system IV protein, VirB3 [Rhizobium etli CIAT 652]
MVSIQSLEDDTLFLACTRPAMIAGVTMEAMGVNIMLTTILYITAGSIAYALVGIVFHVLFRALVKHDHNR
FRILIAWIETRGRSRNSAYWGGSTLSPLTLTRRYDERDLSLG
 
Nucleotide Sequence: 339 bp     [Download]
>gi|190894340|ref|NC_010997.1|:c999456-999118 Rhizobium etli CIAT 652 plasmid pC, complete sequence
ATGGTGAGCATTCAGAGCCTTGAAGATGATACGCTGTTTCTCGCCTGCACCCGCCCGGCAATGATTGCCG
GCGTGACGATGGAGGCGATGGGCGTCAACATCATGTTGACGACCATTCTCTATATCACGGCAGGATCGAT
TGCCTACGCCCTGGTCGGGATCGTTTTCCATGTCCTGTTTCGCGCCCTCGTCAAGCACGACCACAACAGG
TTCCGCATCCTGATCGCGTGGATCGAGACCCGCGGCCGCTCGCGCAATTCCGCTTACTGGGGCGGCTCCA
CACTCTCGCCCCTGACGCTCACCAGGCGCTATGACGAACGGGATTTGAGCCTTGGCTAA
 Primer design