SecReT4
Protein ID: 190895237
T4SS name [ID]VirB [195]
Gene symbolvirB2c
Locus tagRHECIAT_PC0000910
StrainRhizobium etli CIAT 652
Repliconplasmid pC [GenBank: NC_010997] [Browse all T4SS(s) in this replicon]
Location [Strand]999462..999761 [-]
Producttransport secretion system IV protein, VirB2
Component typeVirB2
UniProt IDB3Q3X0
KEGG IDrec:RHECIAT_PC0000910
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 9.7e-25, Aligned region: 5..96
Protein Sequence: 99 a.a.     [Download]
>gi|190895237|ref|YP_001985530.1| transport secretion system IV protein, VirB2 [Rhizobium etli CIAT 652]
MISKASLRPLAASTLMAAAILACLVEPAFAQAAGIESVLQNIVDMLTGNIARLLAVIAVIIICIAWMFGY
MDLRRAGFWIIGIGGIFGATELVNTIVGN
 
Nucleotide Sequence: 300 bp     [Download]
>gi|190894340|ref|NC_010997.1|:c999761-999462 Rhizobium etli CIAT 652 plasmid pC, complete sequence
ATGATCTCCAAAGCCAGCCTTCGCCCGCTTGCCGCATCCACCCTCATGGCGGCCGCCATCCTCGCCTGCC
TGGTCGAACCAGCTTTCGCCCAGGCCGCCGGTATCGAAAGCGTCCTGCAGAACATCGTCGACATGCTGAC
CGGCAATATCGCCCGTCTGCTGGCCGTTATCGCCGTCATCATCATCTGCATCGCCTGGATGTTCGGCTAC
ATGGATTTGAGGCGCGCCGGCTTCTGGATCATCGGGATCGGCGGCATTTTCGGCGCCACCGAGCTGGTCA
ACACCATCGTCGGGAACTGA
 Primer design