SecReT4
Protein ID: 190895238
T4SS name [ID]VirB [195]
Gene symbolvirB1c
Locus tagRHECIAT_PC0000911
StrainRhizobium etli CIAT 652
Repliconplasmid pC [GenBank: NC_010997] [Browse all T4SS(s) in this replicon]
Location [Strand]999758..1000420 [-]
Producttransport secretion system IV protein, VirB1
Component typeVirB1
UniProt IDB3Q3X1
KEGG IDrec:RHECIAT_PC0000911
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 1.6e-08, Aligned region: 8..105
Protein Sequence: 220 a.a.     [Download]
>gi|190895238|ref|YP_001985531.1| transport secretion system IV protein, VirB1 [Rhizobium etli CIAT 652]
MAGSFVDIAQTCAPMVKVETLAGIVSLESRFQPFAVRINSGPPLPAQPVSKAEAIEVATSLIADRQDIQI
GLGGIGIEQLQKLKLSVADAFDPCLNLKATATLLDGYLRVAVRAGDDPALAETVMLQSYYGRDDPSLGAM
VKYDEQVRREAKRLSPILASLTVGEPDSRAGPGEQLQDDAAPALAKQSSQTTEAASWDVFSSRRQSAVLV
FQNDRSEQSE
 
Nucleotide Sequence: 663 bp     [Download]
>gi|190894340|ref|NC_010997.1|:c1000420-999758 Rhizobium etli CIAT 652 plasmid pC, complete sequence
ATGGCCGGTTCTTTCGTCGATATCGCCCAAACCTGCGCACCGATGGTGAAGGTGGAGACGCTTGCAGGCA
TTGTAAGCCTCGAGAGCCGGTTCCAGCCATTTGCCGTTCGCATCAACAGCGGTCCTCCGCTTCCCGCCCA
ACCCGTATCGAAGGCGGAGGCGATCGAGGTCGCCACGTCGCTGATTGCCGACCGCCAGGATATCCAGATC
GGTCTTGGCGGTATTGGCATCGAGCAGCTTCAAAAACTGAAACTATCCGTCGCGGACGCCTTCGATCCCT
GCCTGAACCTCAAGGCCACGGCCACGCTTCTCGATGGATATCTTCGCGTCGCTGTGCGCGCGGGGGACGA
TCCGGCCCTGGCTGAGACAGTGATGCTCCAGTCCTACTACGGCCGCGACGATCCATCCCTCGGCGCCATG
GTCAAATACGACGAGCAGGTGCGCCGGGAAGCAAAGCGGCTATCGCCGATCCTGGCCTCGCTCACCGTCG
GCGAGCCCGATAGCCGGGCCGGCCCTGGCGAGCAGCTGCAAGATGACGCGGCGCCGGCGCTTGCGAAGCA
ATCCTCCCAAACCACCGAGGCCGCGTCCTGGGACGTTTTCAGCTCCCGGCGGCAATCCGCGGTTCTCGTT
TTCCAGAATGATCGATCGGAGCAAAGTGAATGA
 Primer design