SecReT4
Protein ID: 19352385
T4SS name [ID]Trb [61]
Gene symboltrbB
Locus tagpB4p46
Strainuncultured bacterium plasmid pB4 (NC_003430)
Repliconplasmid pB4 [GenBank: NC_003430] [Browse all T4SS(s) in this replicon]
Location [Strand]41819..42784 [+]
Productconjugal transfer ATPase TrbB
Component typeTrbB
UniProt IDQ8RSJ6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 5.4e-86, Aligned region: 27..295
FtsK_SpoIIIE [PF01580], Evalue: 3e-08, Aligned region: 138..195
AAA_10 [PF12846], Evalue: 9.7e-07, Aligned region: 150..198
AAA_16 [PF13191], Evalue: 4.4e-06, Aligned region: 138..177
AAA_19 [PF13245], Evalue: 1.4e-05, Aligned region: 144..189
AAA_29 [PF13555], Evalue: 3.8e-05, Aligned region: 148..171
DUF87 [PF01935], Evalue: 5.7e-05, Aligned region: 150..190
Protein Sequence: 321 a.a.     [Download]
>gi|19352385|ref|NP_598143.1| TrbB protein [uncultured bacterium]
MTEQKLEHNTIKERAKKKLERDMGPELLAALNDPKTVEIMLNADGKVWQEKLGEPMKCIGTLRFAQAQAM
IETIAGYHGKEVTRQRPILEGEFPLDGSRFAGQLPPVVPAPTFAIRKKAVAIFTLAQYVERGIMTAQQRD
SLIAAVRAHRNILVIGGTGSGKTTLVNAIINEMVLQDPTERVFIIEDTGEIQCAAENYVQYHTSIDVTMT
ALLKTTLRMRPDRILVGEVRGPEALDLLMAWNTGHEGGAATLHANNAKAGLDRLAMLISMHPDSPKPIEP
LIGEAVHVVVHIARTPDGSRRIQEILEVSGYANGQYATKTL
 
Nucleotide Sequence: 966 bp     [Download]
>gi|19352339|ref|NC_003430.1|:41819-42784 Uncultured bacterium plasmid pB4, complete sequence
ATGACCGAACAGAAGCTGGAACACAACACGATCAAGGAACGGGCGAAGAAGAAGCTCGAACGCGACATGG
GGCCGGAGCTGTTGGCAGCTCTGAACGATCCCAAGACCGTTGAAATCATGCTCAACGCGGACGGCAAGGT
CTGGCAGGAGAAGCTGGGCGAGCCGATGAAGTGCATCGGCACCCTTCGCTTCGCGCAGGCCCAAGCCATG
ATCGAAACCATTGCCGGCTACCACGGCAAGGAAGTCACGCGGCAGCGGCCGATCCTGGAAGGCGAGTTCC
CGCTAGACGGTAGCCGCTTTGCCGGCCAGCTCCCCCCGGTCGTGCCCGCACCGACCTTTGCGATCCGCAA
GAAGGCGGTCGCCATCTTCACCCTGGCGCAGTACGTCGAGCGCGGAATCATGACCGCGCAGCAGCGCGAT
TCCTTGATTGCCGCCGTGCGTGCCCACCGGAACATCCTGGTGATCGGCGGCACCGGCTCGGGCAAGACCA
CGCTGGTGAACGCGATCATCAACGAGATGGTGCTTCAAGACCCGACCGAACGGGTTTTCATCATCGAGGA
CACCGGCGAAATCCAGTGCGCCGCCGAGAACTACGTCCAGTACCACACCAGCATCGACGTGACCATGACG
GCGCTGCTCAAGACCACGCTGCGCATGCGGCCCGACCGCATCCTGGTCGGCGAAGTGCGCGGCCCCGAAG
CACTTGATCTGTTGATGGCCTGGAACACCGGGCACGAAGGAGGAGCCGCAACCCTGCACGCAAACAACGC
CAAAGCGGGCCTTGATCGGCTCGCCATGCTCATCAGCATGCACCCCGATTCACCCAAACCCATTGAACCG
CTGATAGGCGAGGCGGTTCACGTGGTCGTTCATATCGCCCGCACCCCTGACGGCTCGCGGCGCATCCAGG
AAATCCTTGAGGTTTCCGGCTACGCCAACGGCCAGTACGCAACCAAAACCCTGTAA
 Primer design