SecReT4
Protein ID: 19352386
T4SS name [ID]Trb [61]
Gene symboltrbC
Locus tagpB4p47
Strainuncultured bacterium plasmid pB4 (NC_003430)
Repliconplasmid pB4 [GenBank: NC_003430] [Browse all T4SS(s) in this replicon]
Location [Strand]42798..43262 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDQ8RSJ5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4e-18, Aligned region: 17..110
Protein Sequence: 154 a.a.     [Download]
>gi|19352386|ref|NP_598144.1| TrbC protein [uncultured bacterium]
MQSTLPAFRFDSRAVFYLGMFALLAFFLLAPQHAFASEGTGGSLPYEGWLTNLRNSVTGPVAFALSIIGI
VVAGGILIFGGELNGFFRTLIFIVLVMALLVGAQNMMSTFFGRGAEIAALTDGVLHQAKVAALDMAGFPG
EAIARWAERGHIAG
 
Nucleotide Sequence: 465 bp     [Download]
>gi|19352339|ref|NC_003430.1|:42798-43262 Uncultured bacterium plasmid pB4, complete sequence
ATGCAATCGACCCTTCCCGCGTTCCGCTTCGACAGCCGCGCCGTGTTCTACCTGGGCATGTTCGCCCTCT
TGGCGTTCTTCCTGCTGGCCCCCCAGCACGCTTTCGCCTCCGAAGGCACCGGCGGTTCCCTGCCGTATGA
AGGCTGGTTGACCAACCTGCGCAACAGCGTCACCGGCCCGGTGGCCTTCGCGCTGTCGATCATCGGCATC
GTCGTCGCCGGCGGCATCTTGATCTTCGGCGGCGAACTCAACGGCTTCTTCCGCACGTTGATCTTCATCG
TCCTGGTCATGGCCCTGCTGGTCGGCGCGCAGAACATGATGAGCACCTTCTTCGGCCGTGGCGCGGAAAT
CGCCGCCCTGACCGATGGCGTGCTGCACCAGGCCAAGGTCGCGGCGCTGGACATGGCCGGCTTCCCTGGT
GAAGCCATCGCACGCTGGGCCGAACGCGGCCACATCGCGGGGTAA
 Primer design