SecReT4
Protein ID: 19352387
T4SS name [ID]Trb [61]
Gene symboltrbD
Locus tagpB4p48
Strainuncultured bacterium plasmid pB4 (NC_003430)
Repliconplasmid pB4 [GenBank: NC_003430] [Browse all T4SS(s) in this replicon]
Location [Strand]43266..43577 [+]
Productconjugal transfer protein TrbD
Component typeTrbD
UniProt IDQ8RSJ4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 2.9e-26, Aligned region: 1..87
Protein Sequence: 103 a.a.     [Download]
>gi|19352387|ref|NP_598145.1| TrbD protein [uncultured bacterium]
MALRAIPIRRAGNRENLFMGGDRELVMFSGLLAGALIFSAQEVRATVFGIALWFGALFVLRLMAKSDPKL
RHVYLRHRRYKPYYPARSTPFRENTPSQGKQYK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|19352339|ref|NC_003430.1|:43266-43577 Uncultured bacterium plasmid pB4, complete sequence
ATGGCACTGCGCGCGATCCCCATCCGTAGGGCCGGCAACCGAGAAAACCTGTTCATGGGTGGCGACCGCG
AGCTGGTGATGTTCTCGGGCCTGCTGGCCGGGGCGCTGATTTTCAGCGCCCAAGAAGTGAGGGCAACGGT
GTTCGGCATCGCCTTGTGGTTCGGCGCGTTATTCGTGCTGCGCCTCATGGCGAAGTCCGACCCGAAGCTG
CGACACGTGTACCTGCGGCACCGCCGGTACAAGCCGTACTACCCGGCTCGCAGCACGCCCTTCCGTGAAA
ACACGCCGAGTCAAGGGAAGCAATACAAATGA
 Primer design