SecReT4
Protein ID: 19352388
T4SS name [ID]Trb [61]
Gene symboltrbE
Locus tagpB4p49
Strainuncultured bacterium plasmid pB4 (NC_003430)
Repliconplasmid pB4 [GenBank: NC_003430] [Browse all T4SS(s) in this replicon]
Location [Strand]43574..46132 [+]
Productconjugal transfer protein TrbE
Component typeTrbE
UniProt IDQ8RSJ3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 1.5e-53, Aligned region: 221..431
AAA_10 [PF12846], Evalue: 4.5e-30, Aligned region: 489..772
Protein Sequence: 852 a.a.     [Download]
>gi|19352388|ref|NP_598146.1| TrbE protein [uncultured bacterium]
MIEAIAIGIAVLGAVLLLILFARIRQVDAELKLKKHRSKDAGLADLLNYAAVVDDGVIVGKNGSFMAAWL
YQGDDNASSTEEQREMVSFRINQALAGLGSGWMVHVDAVRRPAPNYSERGVSTFTDPVSAAIDEERRRLF
EGLGTMYEGHFVFAVTWFPPVLAQRKFVELMFDDDAVTPDHTARTVGLIEQFKREIRSLESRMSSAVKLT
RLKGHKIATEEGREVTHDDFLSWLQFCVTGNYHPVQLPSNPMYLDAVIGGQELWGGVVPKIGRKFIQVVS
LEGFPLESTPGLLSALAELPSEYRWSSRFIFMDQHESLKHLDKFRKKWKQKIRGFFDQVFNTNTGSVNQD
AATMVADAEAAIAEVNSGLVAAGYFTSVVVLMDEDRERLAAAALSVEKAINRLAFAARIETINTMDAYLG
SLPGHGVENVRRPLINTMNLADLLPTSSIWTGSATAPCPMYPPLAPALMHCVTVGATPFRLNLHVRDLGH
TFMFGPTGAGKSTHLGIIAAQLRRYAGMSIYAFDKGMSMYPLAAAINAGSKGKTGLHFTVAADDDRLAFC
PLQFLETKADRAWAMEWIDTILALNGVDTTPGQRNEIGHAIMSMHASGARTLSEFSVTIQDEAIREAIKQ
YTVDGSMGHLLDAEEDGLSLSDFTVFEIEELMNLGEKFALPVLLYLFRRIERGLKGQPAVIILDEAWLML
GHPAFRAKIREWLKVLRKANCLVLMATQSLSDAANSGILDVIVESTATKIFLPNVYARDEDTAALYRRMG
LNKRQIEILATAVPKRQYYYVSENGRRLYDLALGPLALAFVGASDKESVAAIKSLQAKFGHEWVDHWLAG
RNLNLNDYLEAA
 
Nucleotide Sequence: 2559 bp     [Download]
>gi|19352339|ref|NC_003430.1|:43574-46132 Uncultured bacterium plasmid pB4, complete sequence
ATGATCGAAGCAATCGCAATTGGCATTGCTGTACTCGGTGCGGTTCTGTTGCTCATCCTCTTTGCCCGTA
TCCGTCAGGTCGATGCCGAGCTGAAGCTCAAGAAGCATCGGTCGAAGGACGCGGGCCTGGCCGACTTGCT
CAACTATGCCGCCGTGGTCGATGACGGCGTGATCGTGGGCAAGAACGGCTCCTTTATGGCCGCCTGGCTG
TACCAAGGGGATGACAACGCCAGCAGCACCGAAGAGCAGCGGGAAATGGTGTCCTTCCGCATCAACCAGG
CCCTGGCGGGCCTGGGCAGCGGCTGGATGGTTCATGTCGATGCCGTGCGCCGGCCGGCACCCAACTACTC
CGAGCGCGGCGTCTCCACCTTCACCGATCCGGTGTCGGCCGCCATTGATGAAGAGCGCCGGCGGCTCTTC
GAGGGCTTGGGCACGATGTACGAAGGGCACTTCGTATTCGCCGTGACCTGGTTTCCGCCAGTGCTGGCCC
AGCGCAAGTTCGTTGAGCTGATGTTTGACGATGACGCGGTGACGCCCGACCACACGGCCCGCACCGTGGG
CCTCATCGAGCAGTTCAAGCGCGAAATCCGCAGCCTGGAATCGCGCATGTCCTCGGCCGTCAAGCTCACG
CGCTTGAAGGGCCACAAGATCGCCACGGAAGAGGGCAGGGAAGTCACGCATGACGACTTCCTGAGCTGGT
TGCAGTTCTGCGTGACCGGCAACTATCACCCGGTGCAGCTCCCCAGCAACCCGATGTACTTGGACGCCGT
GATCGGCGGGCAAGAGCTGTGGGGCGGCGTCGTTCCGAAGATCGGCCGCAAGTTCATCCAGGTGGTGTCC
CTCGAAGGCTTCCCCTTGGAGTCAACGCCTGGCCTGCTGTCGGCCCTGGCCGAGCTGCCGAGTGAATACC
GCTGGTCGAGCCGCTTCATCTTCATGGATCAGCACGAGTCCTTGAAGCACCTGGACAAGTTCCGCAAGAA
GTGGAAGCAGAAGATTCGCGGCTTCTTCGACCAGGTTTTCAACACGAACACCGGCAGCGTCAACCAGGAC
GCGGCAACGATGGTGGCCGATGCCGAGGCGGCCATCGCCGAGGTCAATAGCGGCCTGGTGGCCGCCGGCT
ACTTCACGTCCGTGGTCGTGTTGATGGATGAGGATCGGGAGCGCCTGGCGGCCGCCGCGCTGTCGGTCGA
GAAGGCCATCAACCGGCTGGCCTTCGCGGCACGCATCGAGACGATCAACACGATGGACGCCTACCTGGGC
AGCTTGCCCGGCCACGGCGTCGAGAACGTGCGCCGGCCGCTCATCAACACGATGAACCTGGCCGACCTTC
TGCCGACAAGCTCCATCTGGACGGGCAGCGCCACCGCGCCGTGCCCGATGTACCCGCCGCTGGCCCCGGC
GCTCATGCACTGCGTCACGGTCGGCGCTACGCCCTTCCGGCTGAACCTGCACGTGCGCGACCTGGGCCAC
ACCTTCATGTTCGGCCCGACCGGCGCGGGCAAATCGACGCACCTGGGCATCATCGCCGCGCAGCTCCGGC
GCTATGCCGGCATGTCGATCTACGCCTTCGACAAGGGCATGTCGATGTACCCGCTCGCGGCCGCAATCAA
TGCCGGCTCGAAGGGCAAGACTGGCCTGCACTTCACGGTGGCCGCCGATGATGACCGCCTGGCCTTCTGC
CCGCTCCAGTTCCTCGAAACGAAGGCGGATCGGGCTTGGGCGATGGAGTGGATCGACACGATCCTTGCGC
TCAACGGCGTGGACACCACGCCAGGGCAGCGCAACGAGATCGGCCACGCGATCATGAGCATGCACGCCAG
CGGCGCGCGCACGCTCTCCGAGTTCTCGGTGACGATCCAGGACGAAGCGATCCGCGAGGCCATCAAGCAA
TACACGGTGGACGGCTCGATGGGCCACCTGCTCGATGCCGAAGAGGATGGCCTGTCGCTCTCCGACTTCA
CGGTGTTCGAGATCGAAGAGCTGATGAACCTCGGCGAGAAGTTCGCGCTGCCGGTGCTGCTGTATCTGTT
CCGCCGCATCGAGCGCGGCCTTAAAGGCCAGCCGGCCGTCATCATCCTGGACGAAGCCTGGTTGATGCTG
GGCCACCCGGCGTTCCGCGCCAAGATTCGGGAATGGCTCAAGGTCTTGCGCAAGGCGAACTGCCTGGTGC
TCATGGCTACGCAAAGCCTTTCCGACGCGGCCAACTCGGGCATCTTGGATGTGATCGTGGAATCGACCGC
GACCAAGATTTTCCTGCCGAACGTCTATGCCCGCGACGAGGACACGGCGGCGCTCTATCGCCGCATGGGC
CTCAACAAGCGGCAAATCGAAATCCTCGCCACGGCGGTTCCGAAGCGGCAGTACTACTACGTCTCCGAGA
ACGGCCGCCGCCTCTATGACCTCGCCCTGGGGCCGCTGGCCCTGGCCTTCGTCGGCGCGTCCGACAAGGA
ATCGGTCGCCGCCATCAAGAGCCTGCAAGCGAAGTTCGGCCATGAGTGGGTCGATCACTGGCTGGCCGGC
CGCAATCTGAATCTCAATGACTACCTGGAGGCCGCATGA
 Primer design