SecReT4
Protein ID: 19352389
T4SS name [ID]Trb [61]
Gene symboltrbF
Locus tagpB4p50
Strainuncultured bacterium plasmid pB4 (NC_003430)
Repliconplasmid pB4 [GenBank: NC_003430] [Browse all T4SS(s) in this replicon]
Location [Strand]46129..46917 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDQ8RSJ2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.7e-56, Aligned region: 48..260
Protein Sequence: 262 a.a.     [Download]
>gi|19352389|ref|NP_598147.1| TrbF protein [uncultured bacterium]
MSFADTLKGLIFKKPATAAGRDKRDPRQTDEPLEGGRRQGEAENPYLAARRTWNDHVGGVVSSRQTWQVI
GILSLLIALAGVGGVIHIGSQSKFIPYVVEVDKLGQTVAAGPVQAASKADARVIHATVAEFITDARTVTP
DVALQRRSVFRVYAKLSPNDPATPKMNEWLNGTPDASPFRRAEKEMVNVEIKTAIPQTPDTWQVEWEETA
RDRQGTPKGKPAIWRALVTVYVAEVTPQTTDEQLRNNPLSVYVRDYSWSRVQ
 
Nucleotide Sequence: 789 bp     [Download]
>gi|19352339|ref|NC_003430.1|:46129-46917 Uncultured bacterium plasmid pB4, complete sequence
ATGAGCTTTGCCGACACCCTCAAGGGCTTGATCTTCAAGAAGCCCGCCACGGCCGCAGGACGCGACAAGC
GCGACCCTCGGCAGACCGATGAACCGCTGGAAGGCGGCCGACGCCAGGGCGAGGCCGAGAACCCCTATCT
GGCCGCTCGTCGCACCTGGAACGATCACGTGGGCGGCGTCGTGTCGTCTCGCCAGACCTGGCAAGTGATC
GGCATCTTGTCGCTGTTGATCGCGCTCGCCGGCGTCGGCGGCGTGATCCACATCGGCAGCCAGTCGAAGT
TCATCCCCTACGTGGTGGAAGTGGACAAGCTCGGCCAGACAGTGGCCGCCGGCCCGGTGCAAGCGGCCTC
GAAGGCCGATGCCCGCGTCATCCATGCGACGGTCGCCGAGTTCATCACCGACGCCCGCACGGTCACGCCG
GACGTGGCCTTGCAGCGCCGCTCTGTGTTCCGCGTGTACGCCAAGTTGTCGCCCAACGATCCGGCAACGC
CAAAGATGAATGAGTGGTTGAACGGCACCCCGGATGCCAGCCCGTTCCGTCGCGCTGAAAAGGAAATGGT
GAACGTCGAGATCAAGACGGCCATCCCGCAGACGCCGGACACCTGGCAAGTCGAGTGGGAAGAAACCGCC
CGCGACCGTCAAGGCACACCGAAGGGCAAGCCCGCGATCTGGCGTGCGCTGGTCACTGTGTACGTCGCCG
AAGTCACGCCGCAAACCACGGATGAGCAACTTCGGAACAACCCCCTAAGCGTGTACGTGCGGGACTACTC
CTGGTCGCGCGTTCAATGA
 Primer design